PaperBLAST
PaperBLAST Hits for IAI46_18455 (85 a.a., MFQQEVTITA...)
Show query sequence
>IAI46_18455
MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSDITVTSNGKSASAKSLFKLQTLGLTQGTV
VTISAEGEDEQKAVEHLVKLMAELE
Running BLASTp...
Found 165 similar proteins in the literature:
Hpr / b2415 phosphocarrier protein HPr from Escherichia coli K-12 substr. MG1655 (see 31 papers)
ptsH / P0AA04 phosphocarrier protein HPr from Escherichia coli (strain K12) (see 31 papers)
1j6tB / P0AA04 Complex of enzyme iiamtl and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure (see paper)
ptsH phosphocarrier protein HPr; EC 2.7.11.- from Escherichia coli K12 (see 19 papers)
STM2431 PTS family, Hpr protein, phosphohistidinoprotein-hexose phosphotransferase from Salmonella typhimurium LT2
NP_416910 phosphocarrier protein HPr from Escherichia coli str. K-12 substr. MG1655
P0AA04 Phosphocarrier protein HPr from Escherichia coli (strain K12)
P0AA07 Phosphocarrier protein HPr from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
NP_416910, b2415 phosphohistidinoprotein-hexose phosphotransferase component of PTS system (Hpr) from Escherichia coli str. K-12 substr. MG1655
ECs3287 PTS system protein HPr from Escherichia coli O157:H7 str. Sakai
SF5M90T_2404 phosphocarrier protein Hpr from Escherichia coli
99% identity, 100% coverage
- Ligand: phosphite ion (1j6tB)
- Conserved intergenic sequences revealed by CTAG-profiling in Salmonella: thermodynamic modeling for function prediction
Tang, Scientific reports 2017 - “...STM1943 tRNA-Cys 2496632 STM2385 & STM2386 intergenic region between yfcB and STM2386 2544539 STM2430 & STM2431 intergenic region between cysK and ptsH 2797006 STM2657 23S ribosomal RNA 2797988 STM2657 23S ribosomal RNA 2798973 STM2657 23S ribosomal RNA 2799967 STM2658 tRNA-Sec 2800314 STM2659 16S ribosomal RNA 2801372...”
- Salmonella enterica serovar typhimurium colonizing the lumen of the chicken intestine grows slowly and upregulates a unique set of virulence and metabolism genes
Harvey, Infection and immunity 2011 - “...and metabolism STM2433 STM4231 STM2190 STM0684 STM0685 STM2431 crr lamB mglB nagB nagE ptsH Glucose-specific IIA component Maltoporin precursor Galactose...”
- “...transport and metabolism STM0310 STM1558 STM2431 STM2433 gmhA ptsH crr Phosphoheptose isomerase Putative glycosyl hydrolase Phosphohistidinoprotein-hexose...”
- The general PTS component HPr determines the preference for glucose over mannitol.
Choe, Scientific reports 2017 - GeneRIF: Glucose preference over another phosphoenolpyruvate:sugar phosphotransferase system (PTS) sugar, mannitol, is absolutely dependent on the general PTS component HPr, but not on EIIAGlc, in E. coli. Dephosphorylated HPr accumulates during the transport of glucose and interacts with the mannitol operon regulator, MtlR, to augment its repressor activity.
- The phosphocarrier protein HPr of the bacterial phosphotransferase system globally regulates energy metabolism by directly interacting with multiple enzymes in Escherichia coli.
Rodionova, The Journal of biological chemistry 2017 - GeneRIF: HPr is either phosphorylated on a histidyl residue (HPr-P) or non-phosphorylated (HPr). Data suggest HPr (the non-phosphorylated form) participates in allosteric regulation of the activities of pyruvate kinase (PykF, but not PykA), phosphofructokinase (PfkB, but not PfkA), glucosamine-6-phosphate deaminase (NagB), and adenylate kinase (Adk).
- Sugar Influx Sensing by the Phosphotransferase System of Escherichia coli.
Somavanshi, PLoS biology 2016 - GeneRIF: Results suggest that the phosphoenolpyruvate hexose phosphotransferases PTS network serves as a global sensor of the sugar influx and also monitors the levels of several non-PTS compounds.
- HPr antagonizes the anti-σ70 activity of Rsd in Escherichia coli.
Park, Proceedings of the National Academy of Sciences of the United States of America 2013 - GeneRIF: HPr antagonizes the anti-sigma70 activity of Rsd in Escherichia coli.
- Solution structure of the IIAChitobiose-HPr complex of the N,N'-diacetylchitobiose branch of the Escherichia coli phosphotransferase system.
Jung, The Journal of biological chemistry 2012 - GeneRIF: Data show the active site histidine of histidine phosphocarrier protein HPr, His-15, is buried within the active site cleft of IIA(Chb) formed at the interface of two adjacent subunits of the IIA(Chb) trimer.
- Comparing the predicted and observed properties of proteins encoded in the genome of Escherichia coli K-12.
Link, Electrophoresis 1997 (PubMed)- GeneRIF: N-terminus verified by Edman degradation on complete protein
- Optimization of protein-level tandem mass tag (TMT) labeling conditions in complex samples with top-down proteomics
Guo, Analytica chimica acta 2022 - “...Two examples of identified proteoforms are shown in Figure 1B , Phosphocarrier protein HPr (Uniprot: P0AA04) and Glutaredoxin 3 (Uniprot: P0AC62), which showed multiple labeled products in the MS spectra. For Phosphocarrier protein HPr protein, the dominant peak that represented the completely labeled proteoform was observed...”
- “...pH > 9.1 decreases overlabeling. As shown in Figure 2B , for Phosphocarrier protein HPr (P0AA04), only a very small portion of the overlabeled product was observed in the reaction quenched at high pH (hydroxylamine 1.2%, pH 9.5). Generally, as the quenching pH increased, overlabeling decreased....”
- Characterization of Proteoforms with Unknown Post-translational Modifications Using the MIScore
Kou, Journal of proteome research 2016 - “...addition, two N-terminal methylation sites were reported (M1 in the protein PTHP ECOLI, UniProt ID: P0AA04; M1 in the protein RL23 ECOLI, UniProt ID: P0ADZ0). Because N-terminal methylation has been found in many proteins, 31 these sites may be new identified N-terminal methylation sites. The 5...”
- A genomic reappraisal of symbiotic function in the aphid/Buchnera symbiosis: reduced transporter sets and variable membrane organisations
Charles, PloS one 2011 - “...glucose/mannitol PTS energy coupling Prot Homodimer 0 (c) PtsI:BU064 PtsI:BUsg_061 PtsI:BBp_060 - 8 PTS-HPr 8.A.8.1.1 P0AA04 -31 Glucose/mannitol PTS energy coupling Prot Monomer 0 (c) PtsH:BU065 PtsH:BUsg_062 PtsH:BBp_061 - 9 HCC 9.A.40.1.2 P0A2L3 -112 Mg 2+ Co 2+ [E] nd 0 (nd) YbeX:BU443 YbeX:BUSg_428 CorC:BBp_394 -...”
- The Escherichia coli proteome: past, present, and future prospects
Han, Microbiology and molecular biology reviews : MMBR 2006 - “...P05458 Protease III 5.66/105,113.29 PtsH P0AA04 Phosphocarrier protein HPr 5.65/9,119.37 5.65/10,366 PtsI P08839 Phosphoenolpyruvate-protein phosphotransferase...”
- N-dodecanoyl-homoserine lactone influences the levels of thiol and proteins related to oxidation-reduction process in Salmonella
de, PloS one 2018 - “...fruB Transport ND ND -7.368 1.542 ND ND ND ND ND ND Phosphocarrier protein HPr P0AA07 ptsH Transport 8.437 1.230 7.848 3.151 0.504 0.481 1.948 0.711 -9.520 0.737 Glutamine high-affinity transporter Q7CQW0 glnH Transport ND ND ND ND ND ND -7.105 1.102 ND ND Ferritin Q8ZNU4...”
- FastKnock: an efficient next-generation approach to identify all knockout strategies for strain optimization
Hassani, Microbial cell factories 2024 - “...33.69 b0825, b3946, b3916, b1723 Triple ACKr, GLCpts, PYK 0.56 54.88 b2296, b3115, b1849, b1819, b2415, b2416, b1621, b1101, b2417, b1817, b1818, b1854, b1676 DHAPT, GART, PPAKr Quadruple ACKr, ARGDC, GLCpts, PYK 0.56 64.72 b2296, b3115, b1849, b2938, b4117, b1819, b2415, b2416, b1621, b1101, b2417, b1817,...”
- Construction and analysis of the model of energy metabolism in E. coli
Xu, PloS one 2013 - “...(3) h[p]+nad[c]+q8h2[c] [c] : coa+nad+pyr > accoa+co2+ nadh genes b3736, b3737b3738, b3739b3731,b3732b3733,b3734b3735 b0429, b0430b0431, b0432 b2415, b2416b2417, b2418b2419b1621,b1101b1817,b1818b1818 b1779 b2276, b2277b2278, b2279b2280, b2281b2282, b2283b2284, b2285b2286, b2287b2288 b0114, b0115b0116 2) Reactions of large weight values and their related genes Table 3 shows high w scopes, corresponding reaction...”
- Genome-scale analysis of escherichia coli FNR reveals complex features of transcription factor binding
Myers, PLoS genetics 2013 - “...b1521 Altronate Oxidoreductase + [19] , [145] , (Park and Kiley, Personal Communication) 2531550 ptsH b2415 Phosphoenolpyruvate Dependent Phophotransferase System + [58] , [146] 2632200 guaB b2508 IMP Dehydrogenase + [58] , [147] 3229415 fadH b3081 2,4-Dienoyl-CoA Reductase + + [19] , [148] , (Park and...”
- A genome-scale metabolic reconstruction of Mycoplasma genitalium, iPS189
Suthers, PLoS computational biology 2009 - “...FMETTRS MG365 B. subtilis BSU15730 2E-34 1E-40 [80] phosphotransferase systems a various MG041 E. coli b2415 1E-07 2E-12 Added by GapFill procedure (biomass) glutamyl-tRNA(Gln) amidotransferase GLXAT MG098 M. gallisepticum MGA_0414 1E-60 1E-66 GLXAT MG099 B. subtilis BSU06680 3E-50 1E-57 GLXAT MG100 B. subtilis BSU06690 2E-75 3E-76...”
- Unraveling the evolutionary history of the phosphoryl-transfer chain of the phosphoenolpyruvate:phosphotransferase system through phylogenetic analyses and genome context
Comas, BMC evolutionary biology 2008 - “...the GenBank database using the E. coli EI and HPr sequences (Acc. N NP_416911 and NP_416910 , respectively) and the Bacillus subtilis HPrK sequence (Acc. N NP_391380 ) as query sequences with default settings. The searches were iterated until convergence was attained. From all the sequences...”
- Global gene expression profiling of the asymptomatic bacteriuria Escherichia coli strain 83972 in the human urinary tract
Roos, Infection and immunity 2006 - “...b2579 b1677 b2153 b0114 b3986 b0169 c4310 b4457 b3301 b2415 b3305 b3637 b1779 b3342 b3186 b3307 b4000 b0755 b3340 b3321 b1824 b3316 50S ribosomal subunit...”
- Global transcriptional response of Escherichia coli O157:H7 to growth transitions in glucose minimal medium
Bergholz, BMC microbiology 2007 - “...cvpA -3.35 1 ECs4192 rpsG -2.57 1 ECs3212 mepA -2.29 1 ECs4193 rpsL -2.67 1 ECs3287 ptsH -2.66 1 ECs4204 yheT -2.00 1 ECs3296 cysP -2.17 1 ECs4249 yhgF -2.53 1 ECs3361 purM -4.24 1 ECs4294 yhhA 2.48 2 ECs3387 sseA 2.18 2 ECs4343 nikA -3.22...”
- RNA-seq analysis of the influence of anaerobiosis and FNR on Shigella flexneri
Vergara-Irigaray, BMC genomics 2014 - “...1.83 SF5M90T_2097 yegT putative nucleoside permease protein 1.74 SF5M90T_2897 fba fructose-bisphosphate aldolase, class II 1.56 SF5M90T_2404 ptsH PTS system protein HPr 1.56 SF5M90T_3850 mtlA PTS system, mannitol-specific enzyme IIABC components 1.52 SF5M90T_1640 ydhC putative transport protein 1.51 0.69 SF5M90T_2359 beta-fructosidase 1.49 0.72 SF5M90T_3496 tpiA triosephosphate isomerase...”
YPTB2715 PTS system, phosphocarrier protein from Yersinia pseudotuberculosis IP 32953
YPO2993 PTS system, phosphocarrier protein from Yersinia pestis CO92
96% identity, 100% coverage
- Growth of Yersinia pseudotuberculosis in human plasma: impacts on virulence and metabolic gene expression
Rosso, BMC microbiology 2008 - “...YPTB2463 YPO1608 ptsG , putative PTS system, glucose-specific IIBC component 4.033 (< 0.001) 1.708 (0.027) YPTB2715 YPO2993 ptsH probable PTS system, phosphocarrier protein 1.697 (0.002) 1.422 (0.109) YPTB2716 YPO2994 ptsI putative PTS sytem, enzyme I component 1.946 (< 0.001) 1.351 (0.038) YPTB2717 YPO2995 crr putative PTS...”
- “...solute-binding protein 0.62 (0.029) YPTB2535 (rbsC) YPO2499 putative sugar transport system. permease protein 1.7 (0.013) YPTB2715 (ptsH) YPO2993 PTS system. phosphocarrier protein 1.697 (0.001) YPTB2716 (ptsI) YPO2994 PTS sytem. enzyme I component 1.945 (< 0.001) YPTB2717 (crr) YPO2995 PTS system. glucose-specific IIA component 1.611 (0.002) 0.731...”
- Comparative Global Gene Expression Profiles of Wild-Type Yersinia pestis CO92 and Its Braun Lipoprotein Mutant at Flea and Human Body Temperatures
Galindo, Comparative and functional genomics 2010 - “...Fermentation 6.4 YPO3376 enolase eno Glycolysis/gluconeogenesis 127.7 y1362 IMP dehydrogenase guaB Purine salvage pathway 22 YPO2993 PTS system, phosphocarrier protein hpr Degradation of proteins, peptides, and glycopeptides 29.3 YPO2329 D-lactate dehydrogenase htpH/hslI Fermentation 7 YPO2300 fumarate and nitrate reduction regulatory protein nirR Regulation of metabolic functions...”
- Growth of Yersinia pseudotuberculosis in human plasma: impacts on virulence and metabolic gene expression
Rosso, BMC microbiology 2008 - “...YPO1608 ptsG , putative PTS system, glucose-specific IIBC component 4.033 (< 0.001) 1.708 (0.027) YPTB2715 YPO2993 ptsH probable PTS system, phosphocarrier protein 1.697 (0.002) 1.422 (0.109) YPTB2716 YPO2994 ptsI putative PTS sytem, enzyme I component 1.946 (< 0.001) 1.351 (0.038) YPTB2717 YPO2995 crr putative PTS system,...”
- “...0.62 (0.029) YPTB2535 (rbsC) YPO2499 putative sugar transport system. permease protein 1.7 (0.013) YPTB2715 (ptsH) YPO2993 PTS system. phosphocarrier protein 1.697 (0.001) YPTB2716 (ptsI) YPO2994 PTS sytem. enzyme I component 1.945 (< 0.001) YPTB2717 (crr) YPO2995 PTS system. glucose-specific IIA component 1.611 (0.002) 0.731 (0.028) YPTB2962...”
SG1701 PTS system phosphocarrier protein HPr from Sodalis glossinidius str. 'morsitans'
95% identity, 100% coverage
- Heme-induced genes facilitate endosymbiont (Sodalis glossinidius) colonization of the tsetse fly (Glossina morsitans) midgut
Runyen-Janecky, PLoS neglected tropical diseases 2022 - “...for a PTS system in the D-mannose family), and SG2427-SG2428 (PTS system, unassigned family). Finally, SG1701 , which encodes a homologue of PtsH that is a common component in all PTS sugar transport systems, was induced 2-fold. Blood feeding alters the expression of Sgm heme regulated...”
- “...in an operon that encodes the promiscuous PTS sugar transporter ( SG1327 , ManX), and SG1701 , which encodes a putative homologue of a common component in all PTS sugar transport systems (PtsH), were induced in Sgm under high heme conditions [ 9 , 38 ]....”
NJ56_RS11155 phosphocarrier protein Hpr from Yersinia ruckeri
96% identity, 100% coverage
ETAE_1132 phosphohistidinoprotein-hexose phosphotransferase component of PTS system from Edwardsiella tarda EIB202
96% identity, 100% coverage
- Coordinate regulation of carbohydrate metabolism and virulence by PtsH in pathogen Edwardsiella piscicida
Mao, Applied microbiology and biotechnology 2022 - “...Component Gene Annotation EI EI (PtsI) ETAE_1131 ptsI Phosphoenolpyruvate-protein phosphotransferase (PEP EI) HPr HPr (PtsH) ETAE_1132 ptsH Phosphohistidinoprotein-hexose phosphotransferase component Fructose FPr ETAE_2303 fruB Fructose-specific PTS HPr component EII Fructose EII BC Fru ETAE_2301 fruA Fructose-specific PTS system IIBC component Glucose EIIA Glc ETAE_1130 crr Glucose-specific...”
YE1207 PTS system, phosphocarrier protein from Yersinia enterocolitica subsp. enterocolitica 8081
95% identity, 100% coverage
PMI1828 PTS system phosphocarrier protein from Proteus mirabilis HI4320
88% identity, 100% coverage
BCI_0069 phosphocarrier protein HPr from Baumannia cicadellinicola str. Hc (Homalodisca coagulata)
83% identity, 99% coverage
- Metabolic complementarity and genomics of the dual bacterial symbiosis of sharpshooters
Wu, PLoS biology 2006 - “...CP000238 are EnzymeII Man complex (BCI_04490451), phosphotransferase system Enzyme I (BCI_0070), histidyl phosphorylatable protein PtsH (BCI_0069), mqo type malate dehydrogenase (BCI_0001), NADH dehydrogenase I (BCI_03690381), cytochrome o oxidase (BCI_02670269), ATP synthase (BCI_01400147), glyceraldehyde 3-phosphate dehydrogenase (GapA) (BCI_0443), general amino acid ABC transporter (BCI_0250, BCI_02070208), arginine/lysine ABC...”
PmVP161_0905 phosphocarrier protein Hpr from Pasteurella multocida
81% identity, 100% coverage
CBG46_00240 phosphocarrier protein Hpr from Actinobacillus succinogenes
81% identity, 100% coverage
- Comparative Transcriptome Analysis Reveals the Molecular Mechanisms of Acetic Acid Reduction by Adding NaHSO<sub>3</sub> in <i>Actinobacillus succinogenes</i> GXAS137
Li, Polish journal of microbiology 2023 - “...the resistance of the bacteria to NaHSO 3 . The transcription levels of six genes (CBG46_00240, CBG46_03905, CBG46_00540, CBG46_03900, CBG46_00530, CBG46_03910) involved in the phosphotransferase system (PTS) pathway increased by 1.03, 1.35, 1.78, 1.36, 1.15 and 1.40 log 2 FC, respectively, which encoded phosphocarrier protein HPr...”
HI1713 phosphocarrier protein HPr (ptsH) from Haemophilus influenzae Rd KW20
76% identity, 100% coverage
VC0966 phosphocarrier protein HPr from Vibrio cholerae O1 biovar eltor str. N16961
77% identity, 99% coverage
- HPr prevents FruR-mediated facilitation of RNA polymerase binding to the fru promoter in Vibrio cholerae
Yoon, Nucleic acids research 2023 - “...after in-gel tryptic digestion, this protein was revealed to be the general PTS component, HPr (VC0966). To confirm the specific interaction between FruR and HPr, we conducted a ligand-fishing experiment using hexahistidine-tagged HPr at the N-terminus (His-HPr) as bait with crude extract of WT cells cultured...”
- Lytic transglycosylases mitigate periplasmic crowding by degrading soluble cell wall turnover products
Weaver, eLife 2022 - “...Whole-genome sequencing of three stable suppressors identified three unique mutations: a deletion in ptsH ( vc0966 ), a frameshift mutation in opgH ( vc1287 ), and a deletion mutation affecting both opgH and a downstream gene ( vc1286 ) ( Figure 3C ). ptsH encodes HPr,...”
- Glucose-Specific Enzyme IIA of the Phosphoenolpyruvate:Carbohydrate Phosphotransferase System Modulates Chitin Signaling Pathways in Vibrio cholerae
Yamamoto, Journal of bacteriology 2017 - “...to each other in the following order (Fig. 1C): vc0966 (ptsH encoding Hpr), ptsI, and vc0964 (crr encoding EIIAglc). To examine whether EI is the PTS component...”
- A Genome-Wide Screen Reveals that the Vibrio cholerae Phosphoenolpyruvate Phosphotransferase System Modulates Virulence Gene Expression
Wang, Infection and immunity 2015 - “...of VC0965 (ptsI) pBAD-TOPO carrying a fragment of VC0966 (ptsH) pBAD-TOPO carrying VC0965 with a mutation H189A pBAD-TOPO carrying VC0966 with a mutation H15A...”
- “...VC0965 pCVD442 carrying an unmarked, in-frame deletion in VC0966 pCVD442 carrying an unmarked, in-frame deletion in VC0964 pCVD442 carrying an intact gene...”
- Mannitol and the mannitol-specific enzyme IIB subunit activate Vibrio cholerae biofilm formation
Ymele-Leki, Applied and environmental microbiology 2013 - “...mutant, lacking the operon encoding EI (VC0965), HPr (VC0966), and EIIAGlc (VC0964), is increased (20). To describe differences in gene regulation between this...”
- The Vibrio cholerae mannitol transporter is regulated posttranscriptionally by the MtlS small regulatory RNA
Mustachio, Journal of bacteriology 2012 - “...enzyme I (EI; VC0965) and histidine protein (HPr; VC0966) are upregulated (52); two separate studies also identified EI as necessary for the colonization of...”
- Vibrio cholerae phosphoenolpyruvate phosphotransferase system control of carbohydrate transport, biofilm formation, and colonization of the germfree mouse intestine
Houot, Infection and immunity 2010 - “...VC0965 pWM91 carrying an unmarked, in-frame deletion in VC0966 pWM91 carrying an unmarked, in-frame deletion in VC2533 pWM91 carrying an unmarked, in-frame...”
- “...the coding sequence of VC0965 the coding sequence of VC0966 a VC0966 variant encoding an H-to-A mutation at 12 12 This study the coding sequence of VCA0518...”
- A novel role for enzyme I of the Vibrio cholerae phosphoenolpyruvate phosphotransferase system in regulation of growth in a biofilm
Houot, Journal of bacteriology 2008 - “...at loci VC0964 (encoding EIIAGlc), VC0965 (encoding EI), and VC0966 (encoding HPr). A homolog of EIIBCGlc is encoded at locus VC2013 (Fig. 1B). In previous...”
- “...at loci VC0964 (encoding EIIAGlc), VC0965 (encoding EI), and VC0966 (encoding HPr) of the V. cholerae genome were amplified using the PCR. The gene encoding the...”
- More
VP0795 phosphocarrier protein HPr from Vibrio parahaemolyticus RIMD 2210633
Q87RJ9 Phosphocarrier protein HPr from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
WU75_19555 HPr family phosphocarrier protein from Vibrio parahaemolyticus
76% identity, 99% coverage
- QseC Inhibition as a Novel Antivirulence Strategy for the Prevention of Acute Hepatopancreatic Necrosis Disease (AHPND)-Causing Vibrio parahaemolyticus
Yang, Frontiers in cellular and infection microbiology 2020 - “...protein FlaD VP0793 -2.61879 1.70E-19 Flagellin protein FlaC VP0794 -2.43402 5.55E-16 Flagellar hook-associated protein FlgL VP0795 -2.2913 1.66E-14 Flagellar hook-associated protein FlgK VP0796 -2.39126 1.93E-13 Flagellar protein FlgJ [peptidoglycan hydrolase] VP0797 -2.70585 7.15E-18 Flagellar P-ring protein FlgI VP0798 -2.1387 7.01E-11 Flagellar L-ring protein FlgH VP0799 -2.49074...”
- Gene expression of Vibrio parahaemolyticus growing in laboratory isolation conditions compared to those common in its natural ocean environment
García, BMC microbiology 2017 - “...condition svpa113.1 2014 24,669 -3.0 2.7E 66 RyhB VP1393 19 4134 -7.2 0 BfdA, Hcp1 VP0795 1150 11,616 -2.7 1.2E 116 Histidine-containing phosphocarrier protein VP2157 1169 8519 -2.3 2.6E 27 Glyceraldehyde-3-phosphate dehydrogenase Oddly, the cold shock protein CspA is upregulated about 30 times at 37C, as...”
- Comparative secretomics reveals novel virulence-associated factors of Vibrio parahaemolyticus
He, Frontiers in microbiology 2015 - “...modulation protein VP0556 12,435 6.85 524 48% Primary metabolic process vps2 Q87RJ9 Phosphocarrier protein HPr VP0795 9103 6.25 89 42% Carbohydrate transmembrane transport, cytoplasm vps3 W6DNZ4 30S ribosomal protein S2 rpsB 26,791 8.59 668 47% Structural constituent of ribosome, translation, intracellular vps4 D0M6F3 30S ribosomal protein...”
- Comparative secretomics reveals novel virulence-associated factors of Vibrio parahaemolyticus
He, Frontiers in microbiology 2015 - “...function vps1 Q87S68 Sigma-54 modulation protein VP0556 12,435 6.85 524 48% Primary metabolic process vps2 Q87RJ9 Phosphocarrier protein HPr VP0795 9103 6.25 89 42% Carbohydrate transmembrane transport, cytoplasm vps3 W6DNZ4 30S ribosomal protein S2 rpsB 26,791 8.59 668 47% Structural constituent of ribosome, translation, intracellular vps4...”
- Identification of Antibacterial Components and Modes in the Methanol-Phase Extract from a Herbal Plant Potentilla kleiniana Wight et Arn
Tang, Foods (Basel, Switzerland) 2023 - “...2.36 Molecular chaperone TorD WU75_14970 fruB 2.451 Bifunctional PTS system fructose-Specific transporter subunit IIA/HPr protein WU75_19555 ptsH 3.973 PTS sugar transporter WU75_00455 ulaB 3.977 PTS ascorbate transporter subunit IIB WU75_19550 ptsI 4.075 Phosphoenolpyruvate-protein Phosphotransferase WU75_00460 cmtB 4.118 PTS system mannitol-specific Transporter subunit IIA WU75_01640 cmtB 4.539...”
U876_06295 HPr family phosphocarrier protein from Aeromonas hydrophila NJ-35
76% identity, 100% coverage
VAS14_16916 HPr family phosphocarrier protein from Photobacterium angustum S14
VAS14_16916 phosphocarrier protein HPr from Vibrio angustum S14
70% identity, 84% coverage
- Proteome analysis of the UVB-resistant marine bacterium Photobacterium angustum S14
Matallana-Surget, PloS one 2012 - “...VAS14_02738 hypothetical protein 0.58 0.00 1 0.57 0.00 1 0.51 1.25 2 0.71 0.00 1 VAS14_16916 phosphocarrier protein HPr 0.62 1.33 3 0.67 1.11 5 0.54 1.21 6 0.44 1.20 5 VAS14_04158 arginine ABC transporter 0.68 0.00 1 0.70 0.00 1 0.70 1.28 2 0.99 0.00...”
- “...in the phosphotransferase system were found to be down-regulated under UVB radiation: the Hpr protein (VAS14_16916), pyruvate kinase (VAS14_08125) and PEP synthase (VAS14_10219) ( Tables 1 , 2 ). This major ATP-dependent carbohydrate transport system catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation...”
BB0557 phosphocarrier protein HPr (ptsH-2) from Borrelia burgdorferi B31
54% identity, 94% coverage
- BosR and PlzA reciprocally regulate RpoS function to sustain Borrelia burgdorferi in ticks and mammals
Grassmann, The Journal of clinical investigation 2023 - “...ticks ( 42 , 43 ). Five genes ( bb0166 / malQ , bb0367 , bb0557 / ptsH-2 , bb0559 / crr , and bb0629 / fruA-2 ) encode components of the phosphoenolpyruvate-dependent sugar phosphotransferase system the spirochetes central pathway for carbohydrate transport ( 42 ,...”
- Interaction of the Lyme disease spirochete with its tick vector
Caimano, Cellular microbiology 2016 - “...component ( bb0558 ) and two putative Histidine phosphocarrier protein (Hpr) paralogs ( bb0448 , bb0557 ) that form a phoshorelay system coupled to multiple membrane-associated, sugar-specific Enzyme II (EII) transporters ( Fraser et al., 1997 ; Corona and Schwartz, 2015 ). Glucose, the preferred carbon...”
- Stage-specific global alterations in the transcriptomes of Lyme disease spirochetes during tick feeding and following mammalian host adaptation
Iyer, Molecular microbiology 2015 - “...those encoding transporters or enzymes for carbohydrate or lipid metabolism (lactate dehydrogenase, acyl carrier protein, BB0557 [PtsH-2], BB0559 (glucose-specific EIIA PTS component), BBB29 [MalX2]) are also highly expressed. Table 2 lists the 100 most highly expressed genes in fed nymphs and, for comparison, also includes the...”
- “...Fraser et al. , 1997 ). These include EI (BB0558), two genes annotated as HPr (BB0557, BB0448) and carbohydrate-specific EII components for uptake of glucose, N-acetylglucosamine (GlcNAc), mannose, maltose, trehalose and chitobiose ( Figure 9A ). By homology, BB0559 (EIIA) and BB0645 (EIIBC) are annotated as...”
- Analysis of an ordered, comprehensive STM mutant library in infectious Borrelia burgdorferi: insights into the genes required for mouse infectivity
Lin, PloS one 2012 - “...encoding phosphocarrier protein homologs) had little apparent effect on infectivity. No mutants in ptsH-2 ( bb0557 ) or genes encoding other core PEP-PTS components ( e.g. crr , ptsI, and ptsP ) were isolated. Mutations in the glucose and maltose-specific IIABC component homolog genes malX-1 (...”
- CcpA-dependent carbon catabolite repression in bacteria
Warner, Microbiology and molecular biology reviews : MMBR 2003 - “...burgdorferi Borrelia burgdorferi Treponema pallidum AAG28175 BB0557 BB0448 TP0589 11055615 15594902 15594793 15639577 H-I-IIA N-h-H K-x-H Chlorobi Chlorobium...”
TepiRe1_0766 HPr family phosphocarrier protein from Tepidanaerobacter acetatoxydans Re1
51% identity, 92% coverage
CTK_C17590 HPr family phosphocarrier protein from Clostridium tyrobutyricum
45% identity, 99% coverage
CRH_BACSU / O06976 HPr-like protein Crh; Catabolite repression HPr from Bacillus subtilis (strain 168) (see 3 papers)
NP_391354 catabolite repression HPr-like protein from Bacillus subtilis subsp. subtilis str. 168
47% identity, 98% coverage
- function: Along with seryl-phosphorylated HPr, phosphorylated Crh is implicated in carbon catabolite repression (CCR) of levanase, inositol dehydrogenase, and beta-xylosidase. Exerts its effect on CCR by interacting with CcpA.
subunit: Mixture of monomers and homodimers. Interacts with CcpA as a monomer. - Structural basis for the regulatory interaction of the methylglyoxal synthase MgsA with the carbon flux regulator Crh in Bacillus subtilis.
Dickmanns, The Journal of biological chemistry 2018 - GeneRIF: In vitro cross-linking studies revealed that Crh interacts with the N-terminal helices of MgsA and that the Crh-MgsA binding inactivates MgsA by distorting and thereby blocking its active site.
- Carbon source control of the phosphorylation state of the Bacillus subtilis carbon-flux regulator Crh in vivo.
Landmann, FEMS microbiology letters 2012 (PubMed)- GeneRIF: During exponential growth, ~80% of the Crh molecules were phosphorylated when cells utilized a preferred carbon source.
- Crh, the paralogue of the phosphocarrier protein HPr, controls the methylglyoxal bypass of glycolysis in Bacillus subtilis.
Landmann, Molecular microbiology 2011 (PubMed)- GeneRIF: The authors show here that exclusively the non-phosphorylated form of Crh interacts with MgsA in vivo and inhibits MgsA activity in vitro.
- Phosphoprotein Crh-Ser46-P displays altered binding to CcpA to effect carbon catabolite regulation.
Schumacher, The Journal of biological chemistry 2006 (PubMed)- GeneRIF: the interface between catabolite control protein A (CcpA) and helix alpha 2 of the second contact region (contact region II) of Crh-Ser46-P is necessary and sufficient to throw the allosteric switch to activate cre binding by CcpA.
- X-ray structure of a domain-swapped dimer of Ser46-phosphorylated Crh from Bacillus subtilis.
Chaptal, Proteins 2006 (PubMed)- GeneRIF: X-ray structure of a domain-swapped dimer of Ser46-phosphorylated Crh from Bacillus subtilis
- Quantitative interdependence of coeffectors, CcpA and cre in carbon catabolite regulation of Bacillus subtilis.
Seidel, The FEBS journal 2005 (PubMed)- GeneRIF: Data suggest specific roles for fructose-1,6-bisphosphate and glucose-6-phosphate in enhancing HPrSerP-, but not CrhP-mediated carbon catabolite regulation through CcpA.
X276_20425 HPr family phosphocarrier protein from Clostridium beijerinckii NRRL B-598
Cbei_1219 phosphotransferase system, phosphocarrier protein HPr from Clostridium beijerincki NCIMB 8052
44% identity, 99% coverage
- Transcriptional analysis of amino acid, metal ion, vitamin and carbohydrate uptake in butanol-producing Clostridium beijerinckii NRRL B-598
Vasylkivska, PloS one 2019 - “.... beijerinckii NRRL B-598 includes one copy of each gene encoding the histidine-containing protein PtsH (X276_20425) and enzyme I protein PtsI (X276_25680). It is common in clostridia that genes encoding PtsH and PtsI are located in different parts of the genome, while enzyme II subunits are...”
- Acidogenesis, solventogenesis, metabolic stress response and life cycle changes in Clostridium beijerinckii NRRL B-598 at the transcriptomic level
Patakova, Scientific reports 2019 - “...for transport of different saccharides, which probably share enzyme I protein (X276_25680), histidine-containing protein HPr (X276_20425), and Hpr kinase protein (X276_19670); for their expression profiles see Fig. 2B . These three genes occurred in the genome in single copies, which seems to be common for most...”
- Transcriptional analysis of degenerate strain Clostridium beijerinckii DG-8052 reveals a pleiotropic response to CaCO3-associated recovery of solvent production
Jiao, Scientific reports 2016 - “.... In C. beijerinckii 8052, EI (enzyme I, Cbei_0196) and HPr (heat stable, histidine-phosphorylatable protein, Cbei_1219), phosphorylate the sugar in the cytoplasm, which were all down-regulated in DG-8052 when supplied with CaCO 3 . Except this, other sugar PTS transporters were all not affected, which may...”
- Genome-wide dynamic transcriptional profiling in Clostridium beijerinckii NCIMB 8052 using single-nucleotide resolution RNA-Seq
Wang, BMC genomics 2012 - “...(flavodoxin), and those genes related to cell motility (Cbei_4289), phosphotransferase system (PTS) for sugar uptake (Cbei_1219) and glycolytic activity (Cbei_1903, fba and Cbei_0597, gap ) (Figure 3 and Additional file 2 : Table S2). The time frame of sample D was consistent with the transition to...”
- “...In C. beijerinckii , EI and HPr are encoded by Cbei_0196 ( ptsI ) and Cbei_1219 ( ptsH ) respectively. The expression of both genes was high throughout the fermentation process with a 2- to 3-fold decrease after onset of solventogenesis (Figure 4C ). This agrees...”
CBO2398 phosphocarrier protein HPr from Clostridium botulinum A str. ATCC 3502
42% identity, 100% coverage
H604_RS0100980 HPr family phosphocarrier protein from Ruminococcus gauvreauii DSM 19829
48% identity, 90% coverage
RBAM_RS16170 HPr family phosphocarrier protein from Bacillus velezensis FZB42
47% identity, 91% coverage
ptsH / AAO61680.1 phosphocarrier protein HPr from Clostridium acetobutylicum (see paper)
CAC1820 Phosphocarrier Protein (Hpr) from Clostridium acetobutylicum ATCC 824
41% identity, 99% coverage
F502_04697 HPr family phosphocarrier protein from Clostridium pasteurianum DSM 525 = ATCC 6013
43% identity, 94% coverage
AMUC_RS09380 HPr family phosphocarrier protein from Akkermansia muciniphila
44% identity, 92% coverage
- The effect of bile acids on the growth and global gene expression profiles in Akkermansia muciniphila
Hagi, Applied microbiology and biotechnology 2020 - “...WP_012420873.1 AMUC_RS01425 1.051 1.07E31 gene282 3-Methyl-2-oxobutanoate hydroxymethyltransferase WP_012419313.1 AMUC_RS01260 1.043 2.12E25 gene249 Hypothetical protein WP_042447516.1 AMUC_RS09380 1.039 3.00E79 gene1868 Phosphocarrier protein Hpr WP_012420789.1 AMUC_RS06145 1.017 1.45E06 gene1223 Potassium-transporting ATPase subunit B WP_012420192.1 AMUC_RS02660 1.006 2.49E23 gene530 50S ribosomal protein L21 WP_012419537.1 AMUC_RS06345 0.957 7.49E26 gene1263 50S...”
Csac_2438 Phosphotransferase system, phosphocarrier protein HPr from Caldicellulosiruptor saccharolyticus DSM 8903
41% identity, 94% coverage
PS417_23035 D-trehalose PTS system, I, HPr, and IIA components from Pseudomonas simiae WCS417
43% identity, 10% coverage
- mutant phenotype: Specific phenotype for trehalose and no other trehalose transporter is apparent in the fitness data. The IIB and IIC components are provided by PS417_23050
CPE1669 phosphocarrier protein from Clostridium perfringens str. 13
42% identity, 99% coverage
B5X54_RS01280 HPr family phosphocarrier protein from Caldicellulosiruptor bescii
39% identity, 98% coverage
- Gene targets for engineering osmotolerance in Caldicellulosiruptor bescii
Sander, Biotechnology for biofuels 2020 - “...transporter subunit IIA 4.5 0.7 4.5 B5X54_RS01275 PTS fructose transporter subunit IIBC 4.8 0.6 4.3 B5X54_RS01280 HPr family phosphocarrier protein 4.1 0.8 3.7 B5X54_RS01285 Phosphoenolpyruvate-protein phosphotransferase 4.5 0.6 4.0 B5X54_RS01290 Acetylesterase 2.4 0.4 2.7 B5X54_RS04520 Transposase 1.4 1.8 0.6 B5X54_RS04525 Sporulation sigma factor SigE 1.5 1.4...”
Lreu_1325 phosphocarrier protein HPr from Lactobacillus reuteri DSM 20016
Lreu_1325 phosphocarrier protein HPr from Limosilactobacillus reuteri subsp. reuteri
42% identity, 92% coverage
AO353_15995 trehalose-specific PTS system, I, HPr, and IIA components from Pseudomonas fluorescens FW300-N2E3
41% identity, 10% coverage
- mutant phenotype: Specific phenotype on trehalose. The IIB/IIC components are provided by AO353_15980. 45% similar to a NAG PTS system (PA3760, PMC:PMC2542419)
PFL_4931 phosphoenolpyruvate-protein phosphotransferase from Pseudomonas fluorescens Pf-5
40% identity, 10% coverage
L21SP2_2173 HPr family phosphocarrier protein from Salinispira pacifica
37% identity, 93% coverage
LBA0639 phosphocarrier protein HPr from Lactobacillus acidophilus NCFM
41% identity, 92% coverage
- Transcriptional analysis of prebiotic uptake and catabolism by Lactobacillus acidophilus NCFM
Andersen, PloS one 2012 - “...via catabolite control protein A ( ccpA , LBA0431), phosphocarrier protein HPR ( ptsH , LBA0639), and HPr kinase/phosphorylase ( ptsK LBA0676) linking the regulation to the phosphorylation cascade of EI through EIIA to the PTS permeases [27] . 10.1371/journal.pone.0044409.g003 Figure 3 Organization of gene clusters...”
- Transcriptional and functional analysis of galactooligosaccharide uptake by lacS in Lactobacillus acidophilus
Andersen, Proceedings of the National Academy of Sciences of the United States of America 2011 - “...at the transcriptional level, likely depending upon HPr (ptsH, LBA0639), CcpA (ccpA, LBA0431), and HPrK/P (ptsK, LBA0676), all of which are encoded in the L....”
FN1794 Phosphocarrier protein HPr from Fusobacterium nucleatum subsp. nucleatum ATCC 25586
42% identity, 98% coverage
- CcpA-dependent carbon catabolite repression in bacteria
Warner, Microbiology and molecular biology reviews : MMBR 2003 - “...Fusobacterium nucleatum Fusobacterium nucleatum FN1782 FN1794 19705087 19705099 H H-I Actinobacteria Corynebacterium glutamicum Streptomyces coelicolor...”
- “...F. nucleatum contains two HPr-like molecules, one of which, FN1794, is adjacent to the gene coding for PTS EI, indicating that FN1794 is HPr. The second gene,...”
PTHP_LYSSH / Q84F84 Phosphocarrier protein HPr; Histidine-containing protein from Lysinibacillus sphaericus (Bacillus sphaericus) (see paper)
42% identity, 95% coverage
- function: General (non sugar-specific) component of the phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS). This major carbohydrate active-transport system catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The phosphoryl group from phosphoenolpyruvate (PEP) is transferred to the phosphoryl carrier protein HPr by enzyme I. Phospho-HPr then transfers it to the PTS EIIA domain.
function: P-Ser-HPr interacts with the catabolite control protein A (CcpA), forming a complex that binds to DNA at the catabolite response elements cre, operator sites preceding a large number of catabolite- regulated genes. Thus, P-Ser-HPr is a corepressor in carbon catabolite repression (CCR), a mechanism that allows bacteria to coordinate and optimize the utilization of available carbon sources. P-Ser-HPr also plays a role in inducer exclusion, in which it probably interacts with several non-PTS permeases and inhibits their transport activity (By similarity). - The histidine-phosphocarrier protein of the phosphoenolpyruvate: sugar phosphotransferase system of Bacillus sphaericus self-associates.
Doménech, PloS one 2013 - “...sc from (PT1_STRCO) were extracted from the UniProtKB/Swiss-Prot server ( www.uniprot.org/uniprot/ ), with extraction codes Q84F84 and Q9KZP1, respectively. The NMR structure of the EIN:HPr complex from E. coli [21] was used as structural template (PDB code 3EZA). Residues 8289 of HPr bs were modelled from...”
Q9ZAD9 Phosphocarrier protein HPr from Lactococcus lactis subsp. cremoris
43% identity, 92% coverage
EMQU_0954 phosphocarrier protein HPr from Enterococcus mundtii QU 25
41% identity, 92% coverage
- Transcriptome profile of carbon catabolite repression in an efficient l-(+)-lactic acid-producing bacterium Enterococcus mundtii QU25 grown in media with combinations of cellobiose, xylose, and glucose
Shiwa, PloS one 2020 - “...EMQU_0715 fba fructose-bisphosphate aldolase 1247.5 1981.4 1267.1 1458.1 2105.6 1.02 1.15 1.66 1.44 CCR proteins EMQU_0954 ptsH (HPr) phosphocarrier protein HPr 976.8 2275.5 2547.8 646.0 3230.7 2.61 0.25 1.27 5.00 EMQU_1943 ccpA catabolite control protein A 91.6 148.0 132.3 267.6 226.3 1.44 2.02 1.71 0.85 EMQU_1951...”
- “...CcpA-dependent CCR pathway of Firmicutes in response to glucose, including CcpA (EMQU_1943), histidine-containing protein (HPr) (EMQU_0954), and HPr kinase/phosphorylase (EMQU_1951) [ 11 , 12 ]. While ccpA and hprK (encoding HPr kinase/phosphorylase) were constitutively expressed under all conditions tested, the expression of ptsH (HPr) was approximately...”
- Complete genome sequence of Enterococcus mundtii QU 25, an efficient L-(+)-lactic acid-producing bacterium
Shiwa, DNA research : an international journal for rapid publication of reports on genes and genomes 2014 - “...histidine-containing protein (P-Ser-HPr) in CCR have been well studied. 41 Genes encoding CcpA (EMQU_1943), HPr (EMQU_0954), and HPr kinase/phosphorylase (EMQU_1951) were also found in the QU 25 genome. The mechanism by which CCR is prevented in the presence of glucose is still unknown. Strain QU 25...”
PTFAH_HAEIN / P44715 Multiphosphoryl transfer protein; MTP; Diphosphoryl transfer protein; DTP; Phosphotransferase FPr protein; Pseudo-HPr from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see paper)
HI0448 PTS system, fructose-specific IIA/FPr component (fruB) from Haemophilus influenzae Rd KW20
48% identity, 15% coverage
UC7_RS15600 phosphocarrier protein HPr from Enterococcus caccae ATCC BAA-1240
42% identity, 92% coverage
- Apigenin Impacts the Growth of the Gut Microbiota and Alters the Gene Expression of Enterococcus
Wang, Molecules (Basel, Switzerland) 2017 - “...UC7_RS13160 penicillin-binding protein 1.5 Cell wall synthesis UC7_RS15715 50S ribosomal protein L10 1.5 Protein translation UC7_RS15600 phosphocarrier protein HPr 1.5 Carbohydrate phosphorylation UC7_RS13265 hypothetical protein 1.5 Unknown UC7_RS15250 hypothetical protein 1.5 Unknown UC7_RS12410 signal peptidase I 1.5 Protein maturation (B) Enterococcus caccae Genes Downregulated in Response...”
BAS5001 phosphocarrier protein HPr from Bacillus anthracis str. Sterne
42% identity, 81% coverage
- Retrobiosynthetic approach delineates the biosynthetic pathway and the structure of the acyl chain of mycobacterial glycopeptidolipids
Vats, The Journal of biological chemistry 2012 - “...was dried and analyzed using phosphorimaging (Fuji BAS5001). Enzymatic Assay and Product Characterization--PKS enzymatic assays induced 100 mM phosphate buffer...”
- Two functionally distinctive phosphopantetheinyl transferases from amoeba Dictyostelium discoideum
Nair, PloS one 2011 - “...at 30C. Samples were loaded on SDS-PAGE, gel was dried and analyzed using a phosphorimager (BAS5001). Kinetic Analysis Kinetic parameters for DiAcpS and DiSfp were determined with 20 M of either of the PPTase, and 545 M [1- 14 C] acetyl-CoA. Concentration of mycobacterial PKS2 and...”
- Novel intermolecular iterative mechanism for biosynthesis of mycoketide catalyzed by a bimodular polyketide synthase
Chopra, PLoS biology 2008 - “...the dye front ran out. The gel was dried and analyzed using a phosphorImager (Fuji BAS5001). Product formation assays. PKS12 enzymatic assays included 100 mM phosphate buffer (pH 7.2), 150 M acyl-NACs, 75 M MCoA, 75 M MMCoA, 7.2 M 14 C-MCoA, 7.2 M 14 C-MMCoA,...”
- “...(IN/US system -RAM Model 3). For kinetic analysis, radiolabeled products were quantified using PhosphorImager (Fuji BAS5001). For competition experiments, the competing proteins (Cter, Cter-Nter, and BSA) were titrated into reaction mixtures containing 100 mM phosphate buffer (pH 7.2), 75 M MCoA, 7.2 M 14 C-MCoA, 4...”
Ethha_2064 HPr family phosphocarrier protein from Ethanoligenens harbinense YUAN-3
41% identity, 93% coverage
ptsH / AAC45390.1 HPr from Lactobacillus sakei (see paper)
O07125 Phosphocarrier protein HPr from Latilactobacillus sakei
LSA1463 Phosphocarrier protein HPr (Histidine-containing protein) from Lactobacillus sakei subsp. sakei 23K
40% identity, 92% coverage
CCNA_00241 phosphocarrier protein HPr from Caulobacter crescentus NA1000
CC0241 phosphocarrier protein HPr from Caulobacter crescentus CB15
40% identity, 88% coverage
PTHP_BACSU / P08877 Phosphocarrier protein HPr; Histidine-containing protein from Bacillus subtilis (strain 168) (see paper)
NP_389273 histidine-containing phosphocarrier protein of the phosphotransferase system (PTS) (HPr protein) from Bacillus subtilis subsp. subtilis str. 168
BSU13900 phosphocarrier protein HPr from Bacillus subtilis subsp. subtilis str. 168
37% identity, 92% coverage
- function: General (non sugar-specific) component of the phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS). This major carbohydrate active-transport system catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The phosphoryl group from phosphoenolpyruvate (PEP) is transferred to the phosphoryl carrier protein HPr by enzyme I. Phospho-HPr then transfers it to the PTS EIIA domain
function: P-Ser-HPr interacts with the catabolite control protein A (CcpA), forming a complex that binds to DNA at the catabolite response elements cre, operator sites preceding a large number of catabolite- regulated genes. Thus, P-Ser-HPr is a corepressor in carbon catabolite repression (CCR), a mechanism that allows bacteria to coordinate and optimize the utilization of available carbon sources. P-Ser-HPr also plays a role in inducer exclusion, in which it probably interacts with several non-PTS permeases and inhibits their transport activity - Control of the phosphorylation state of the HPr protein of the phosphotransferase system in Bacillus subtilis: implication of the protein phosphatase PrpC.
Singh, Journal of molecular microbiology and biotechnology 2007 (PubMed)- GeneRIF: Results show that in addition to the phosphorylase activity of the HPr kinase/phosphorylase, the serine/threonine protein phosphatase PrpC uses HPr(Ser-P) as a target.
- Quantitative interdependence of coeffectors, CcpA and cre in carbon catabolite regulation of Bacillus subtilis.
Seidel, The FEBS journal 2005 (PubMed)- GeneRIF: Data suggest specific roles for fructose-1,6-bisphosphate and glucose-6-phosphate in enhancing HPrSerP-, but not CrhP-mediated carbon catabolite regulation through CcpA.
- Prediction of prkC-mediated protein serine/threonine phosphorylation sites for bacteria
Zhang, PloS one 2018 - “...Bacillus subtilis 20389117 P39126 396 icd Bacillus subtilis 20389117 Q04777 88 alsD Bacillus subtilis 20389117 P08877 12 ptsH Bacillus subtilis 20389117 O34530 166 rsgA Bacillus subtilis 22544754 O34530 192 rsgA Bacillus subtilis 19246764 O34530 226 rsgA Bacillus subtilis 19246764 P33166 385 tuf Bacillus subtilis 19246764 The...”
- Implications of carbon catabolite repression for plant-microbe interactions
Franzino, Plant communications 2022 - “...and PTS (ECK2412) proteins from E.coli (strain K12) or CcpA (BSU29740), HprK (BSU35000), and HpR (BSU13900) proteins from Bacillus subtilis (strain 168) using MicroScope and NCBI genome databases. The E.coli CCR system was found in different Proteobacteria, and the Bacillus CCR system was present in members...”
- The Blueprint of a Minimal Cell: MiniBacillus
Reuß, Microbiology and molecular biology reviews : MMBR 2016 - “...BSU25460 BSU25470 BSU25480 BSU28230 Yes No No No No BSU13890 BSU13900 BSU13910 BSU31350 BSU29190 BSU37120 BSU33920 BSU33940 No No No No No No No Yes Yes Yes Yes...”
CDR20291_2644 HPr family phosphocarrier protein from Clostridioides difficile R20291
CD2756 PTS system, phosphocarrier protein from Clostridium difficile 630
CDR20291_2644 PTS system, phosphocarrier protein from Clostridium difficile R20291
39% identity, 93% coverage
- Environmental transmission of Clostridioides difficile ribotype 027 at a long-term care facility; an outbreak investigation guided by whole genome sequencing
Endres, Infection control and hospital epidemiology 2018 - “...G G G G G G G G G G G G G G 3113416 CDR20291_2644 PTS system, phosphocarrier protein Non-synonymous G G G G G G G G G G G G G A G G G G 3164340 CDR20291_2682 Cell surface protein (S-layer precursor...”
- Genome-Wide Transcription Start Site Mapping and Promoter Assignments to a Sigma Factor in the Human Enteropathogen Clostridioides difficile
Soutourina, Frontiers in microbiology 2020 - “...1A ). CD1329 gene encoding RNaseY, CD1392 gene encoding a putative ribonuclease and ptsH ( CD2756 ) gene encoding HPr protein of PTS system also presented a complex profile with several potential cleavage sites inside the gene ( Supplementary Figure S6 ). Interestingly, a potential cleavage...”
- Temporal differential proteomes of Clostridium difficile in the pig ileal-ligated loop model
Janvilisri, PloS one 2012 - “...including PtsG (CD2667), MalX (CD3030), and CD3137 were down-regulated, others including CD0287, GatC (CD2325), PtsH (CD2756), CD3068, and CD3069 were found to be up-regulated. These results suggest that the changes in metabolic states of C. difficile within the host environments may provide another mechanism for host...”
M5595_19190 HPr family phosphocarrier protein from Eubacterium limosum
38% identity, 91% coverage
LEUM_1780 Phosphotransferase system, HPr-related protein from Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
41% identity, 84% coverage
EF0709 phosphocarrier protein HPr from Enterococcus faecalis V583
H9Q64_RS06955, HMPREF9494_02513 phosphocarrier protein HPr from Enterococcus faecalis TX2137
38% identity, 92% coverage
- The Intraperitoneal Transcriptome of the Opportunistic Pathogen Enterococcus faecalis in Mice
Muller, PloS one 2015 - “...inside the host. We noticed that the general phosphotransferase system (PTS) proteins HPr and EI (EF0709 and EF0710, respectively) are significantly downregulated (-4.9-fold) as well as a fructose specific PTS (EF0717; -15.7-fold) ( S4 Table and Fig 2 ). This suggests that PTS sugars may be...”
- Using a genome-scale metabolic model of Enterococcus faecalis V583 to assess amino acid uptake and its impact on central metabolism
Veith, Applied and environmental microbiology 2015 - “...the phosphocarrier protein (HPr; ptsH, EF0709) at Ser-46 (P-SerHPr), a component of the phosphoenolpyruvate-carbohydrate phosphotransferase system,...”
- Enterococcus faecalis Glycolipids Modulate Lipoprotein-Content of the Bacterial Cell Membrane and Host Immune Response
Theilacker, PloS one 2015 - “...-1.642 50S ribosomal protein L7 L12 cytoplasmic EF2729 -1.689 Transcription termination antitermination protein nusG cytoplasmic EF0709 -1.708 Phosphocarrier protein HPr cytoplasmic EF2415 -1.738 Uncharacterized protein cytoplasmic EF0220 -1.846 30S ribosomal protein S8 cytoplasmic EF2719 -1.847 50S ribosomal protein L11 cytoplasmic EF0079 -1.896 Gls24 protein cytoplasmic EF0820...”
- CspR, a cold shock RNA-binding protein involved in the long-term survival and the virulence of Enterococcus faecalis
Michaux, Journal of bacteriology 2012 - “...change in expression using: Protein name EF3115 EF0709 (ptsH) EF0211 (rplV) EF1217 EF1218 Conserved hypothetical protein Phosphocarrier protein HPr 50S...”
- “...the mutant strain, respectively. Among these, the protein Ef0709, which corresponds to the phosphocarrier protein HPr, was 24-fold more abundant in the cspR...”
- Identification of proteins related to the stress response in Enterococcus faecalis V583 caused by bovine bile
Bøhle, Proteome science 2010 - “...26.1 5.92 35 10 1.70 0.37 0.55 6 Transport and binding protein Phosphocarrier protein HPr EF0709 9.3 4.92 13 11 0.99 0.70 0.52 7 e PTS system, mannose-specific IIAB components EF0020 35.5 5.11 50 22 1.62 3.06 0.90 8 peptide ABC transporter, ATP-binding protein EF0912 35.9...”
- “...fatty acid synthesis towards generation of ATP. Three transporter and binding proteins were identified (EF0020, EF0709 and EF0912). The IIAB component of a mannose-specific phosphotransferase system (PTS; EF0020) was strongly up-regulated. Interestingly, there are studies showing that this type of transporter is important for the survival...”
- Phage Cocktails Constrain the Growth of Enterococcus
Wandro, mSystems 2022 - “...Bop Epimerase/dehydratase HMPREF9494_02361 SNP EpaW EF_2171 D229Y, G192V E. faecalis TX2137 Bop Phosphocarrier protein HPr HMPREF9494_02513 SNP V209L E. faecalis TX2137 Bop, phiV12 Bacterial sugar transferase HMPREF9494_02367 SNP EpaR EF_2177 R400C, G251R E. faecalis TX2137 phiV12 DNA ligase (NAD + ) HMPREF9494_02501 SNP A434E E. faecium...”
- Genetically distant bacteriophages select for unique genomic changes in Enterococcus faecalis
Johnson, MicrobiologyOpen 2022 - “...1793226 H9Q64_RS09850 Sugar transferase, epaR Thr296Ile 43 4 1157622 Intergenic region NA 39 5 1234192 H9Q64_RS06955 Directly upstream of ptsP, phosphocarrier protein HPr Ala16Val 44 1793154 H9Q64_RS09850 Sugar transferase, epaR Pro320Leu 52 Note : Mutations found in bacterial controls are excluded from this final list. NA...”
- “...54dependent transcriptional regulator Ala439insValLys 82 Culture 5 Colony 1 127840 H9Q64_RS01755 Transposase Arg144Leu 33 1234192 H9Q64_RS06955 Directly upstream of ptsP, phosphocarrier protein HPr Ala16Val 100 1793154 H9Q64_RS09850 Sugar transferase, epaR Pro320Leu 100 Culture 5 Colony 2 1488410 H9Q64_RS08225 PTS mannitol transporter subunit IICBA Met1? 99 1792160...”
A0J47_RS08260 fused PTS fructose transporter subunit IIA/HPr protein from Photobacterium damselae subsp. damselae
44% identity, 20% coverage
XAC2501 multiphosphoryl transfer protein from Xanthomonas axonopodis pv. citri str. 306
41% identity, 10% coverage
GJQ69_02120 HPr family phosphocarrier protein from Caproicibacterium lactatifermentans
40% identity, 93% coverage
XAUB_05120 phosphoenolpyruvate--protein phosphotransferase from Xanthomonas citri pv. aurantifolii str. ICPB 11122
41% identity, 10% coverage
LSEI_1760 Phosphotransferase system, HPr-related protein from Lactobacillus casei ATCC 334
LGG_01821 PTS phosphocarrier protein Hpr (histidine containing protein) from Lactobacillus rhamnosus GG
LCAKO_1965, LGG_01821 phosphocarrier protein HPr from Lacticaseibacillus rhamnosus GG
46% identity, 76% coverage
- Functional genomics of Lactobacillus casei establishment in the gut
Licandro-Seraut, Proceedings of the National Academy of Sciences of the United States of America 2014 - “...kinase, LSEI_1759, which acts with the phosphocarrier HPr, LSEI_1760; no mutant available) as an energy coupling protein. The ptsI-deficient mutant of L. casei...”
- Proteomics and transcriptomics characterization of bile stress response in probiotic Lactobacillus rhamnosus GG
Koskenniemi, Molecular & cellular proteomics : MCP 2011 - “...LGG_01367 LGG_01478 LGG_01652 LGG_01820 LGG_02239 LGG_01821 LGG_01821 LGG_01823 LGG_01823 LGG_01823 LGG_01823 LGG_01823 LGG_01823 LGG_01930 LGG_02484 LGG_02050...”
- Growth phase-associated changes in the proteome and transcriptome of Lactobacillus rhamnosus GG in industrial-type whey medium
Laakso, Microbial biotechnology 2011 - “...1.344 LGG_01465 fhs Formatetetrahydrofolate ligase 124 1.9 1.209 LGG_01468 Nitroreductase family protein 125,126 3.6 3.852 LGG_01821 ptsH Phosphocarrier protein HPr 127 2.2 0.884 LGG_01837 mvaS HydroxymethylglutarylCoA synthase 128 1.5 0.071 LGG_02050 glf UDPgalactopyranose mutase 129 1.7 1.711 LGG_02098 Conserved protein 130 2.4 0.526 LGG_02415 cueO Multicopper...”
- Comparative genomics and functional analysis of a highly adhesive dairy Lactobacillus paracasei subsp. paracasei IBB3423 strain
Koryszewska-Bagińska, Applied microbiology and biotechnology 2019 - “...network were identified, namely catabolite control protein A (CcpA; LCAKO_0880), phosphoryl transfer enzyme I (EI) (LCAKO_1965), HPr (LCAKO_1964), and HPr kinase/phosphorylase (LCAKO_1110). The capacity to metabolize complex carbohydrates such as inulin is reflected in the IBB3423 genome. A putative operon involved in inulin degradation homologous to...”
OEOE_RS03075 phosphocarrier protein HPr from Oenococcus oeni PSU-1
40% identity, 86% coverage
- Transcriptomic and Proteomic Analysis of Oenococcus oeni Adaptation to Wine Stress Conditions
Margalef-Català, Frontiers in microbiology 2016 - “...PTS mannose transporter subunit IID OEOE_RS02240 0.76 1.08 1.43 1.43 1.23 0.97 Phosphocarrier protein hpr OEOE_RS03075 2.19 2.16 2.20 2.33 2.25 2.32 Lactate dehydrogenase OEOE_RS05695 1.20 0.93 1.10 1.22 1.14 1.37 PTS sugar transporter OEOE_RS05805 2.37 2.45 2.68 2.86 2.87 2.90 Glycerol-3-phosphate ABC transporter ATP-binding protein...”
- “...EIIAB OEOE_RS02230 2.4 0.7 35.6 HPr kinase/phosphorylase OEOE_RS02680 1.6 1.9 35.4 5.3 Phosphocarrier protein HPr OEOE_RS03075 0.7 2.3 9.0 Phosphoenol pyruvate-protein phosphotransferase OEOE_RS03095 1.2 ND 63.2 5 Galactose mutarotase OEOE_RS04920 0.7 1.1 34.1 D-lactate dehydrogenase OEOE_RS05695 1.3 ND 36.5 5.74 UDP-glucose 4-epimerase OEOE_RS06755 1.1 0.7 36.9...”
BBMN68_1152 HPr family phosphocarrier protein from Bifidobacterium longum subsp. longum BBMN68
36% identity, 90% coverage
lp_1273 phosphocarrier protein Hpr from Lactobacillus plantarum WCFS1
40% identity, 92% coverage
ptsH / AAA16213.1 phosphocarrier protein from Mycoplasma capricolum (see paper)
NO343_00615 HPr family phosphocarrier protein from Mycoplasma capricolum subsp. capricolum
37% identity, 85% coverage
XF1403 phosphotransferase system HPr enzyme from Xylella fastidiosa 9a5c
35% identity, 84% coverage
- CcpA-dependent carbon catabolite repression in bacteria
Warner, Microbiology and molecular biology reviews : MMBR 2003 - “...PTSO PTSO VC2533 Z4879 STY4004 PTSH PTSH XF1403 GMETP32 DDES2010 131536 16123174 21039016 16273600 23466976 15602763 15616690 21622959 15640982 16765751...”
- Whole-genome analysis of transporters in the plant pathogen Xylella fastidiosa
Meidanis, Microbiology and molecular biology reviews : MMBR 2002 - “...HPr protein (8.A.8) are present in a cluster (XF1402 and XF1403) (Table 6). On the other hand, no permeases have been found. The best candidate in the entire...”
- “...1 1 Sugar XF0367 XF1402 0 8.A.5.1.1 8.A.7.1.1 XF1403 VICb Enzyme I 8.A.8.1.1 Voltage-gated K channel beta subunit COG0845 (140 proteins), membrane fusion...”
SPD_1040 phosphocarrier protein HPr from Streptococcus pneumoniae D39
45% identity, 77% coverage
- StkP- and PhpP-Mediated Posttranslational Modifications Modulate the S. pneumoniae Metabolism, Polysaccharide Capsule, and Virulence
Kant, Infection and immunity 2023 - “...and D39StkP mutants ( ccpA / spd_1797 , 1.25 PhpP /-1.46 StkP -fold; ptsH/hpr / spd_1040 , 1.13 PhpP /1.67 StkP -fold; and hprK/P/spd_1244 , 1.17 PhpP /1.04 StkP -fold). Based on these results showing modulated functional expression of several genes, including those encoding the proteins...”
- Cadmium stress dictates central carbon flux and alters membrane composition in Streptococcus pneumoniae
Neville, Communications biology 2020 - “...(EC 2.7.1.40) 1.31 SPD_1012 eno Enolase (EC 4.2.1.11) 1.22 SPD_1039 ptsI Phosphocarrier protein HPr 1.30 SPD_1040 ptsH Phosphoenolpyruvate-protein phosphotransferase (EC 2.7.3.9) 1.31 SPD_1468 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (EC 5.4.2.11) 1.44 Pyruvate metabolism SPD_0420 pflB Formate acetyltransferase (EC 2.3.1.54) 1.41 SPD_0636 spxB Pyruvate oxidase (EC 1.2.3.3) 1.33...”
- Proteomic Investigation Uncovers Potential Targets and Target Sites of Pneumococcal Serine-Threonine Kinase StkP and Phosphatase PhpP
Hirschfeld, Frontiers in microbiology 2019 - “...identified in this study. Significance Locus ID Peptides inclusive phosphosites Protein description Biological process *** SPD_1040 DFHVVAE T 12 GIHAR Phosphocarrier protein HPr Carbohydrates, organic alcohols and acids *** SPD_1474 EVVSEVLGEPIPAPIEEEPIDM T 201 R Cell division protein DivIVA Cell division *** SPD_1479 HFDMAE T 356 VELPK...”
- “...GNGHVQLFAK Pyruvate kinase Pyk Glycolysis/Gluconeogenesis SPD_0790 FNF S 58 HGDHQEQGER Pyruvate kinase Pyk Glycolysis/Gluconeogenesis * SPD_1040 S 46 IMGV M SLGVGQGADVTISAEGADADDAIAAISETMEK Phosphocarrier protein PtsH Carbohydrates, organic alcohols and acids * SPD_1040 SI M GV MS 52 LGVGQGADVTISAEGADADDAIAAISET M EK Phosphocarrier protein PtsH Carbohydrates, organic alcohols and...”
- The Small Molecule DAM Inhibitor, Pyrimidinedione, Disrupts Streptococcus pneumoniae Biofilm Growth In Vitro
Yadav, PloS one 2015 - “...sensor kinase activity -1.5 (0.003) SPD_2065 (comC1) competence-stimulating peptide type 1 Two-component system -1.5 (0.005) SPD_1040 (ptsH) phosphocarrier protein HPr protein serine/threonine kinase activity phosphoenolpyruvate-dependent sugar phosphotransferase system -1.6 (0.005) Membrane protein SPD_0080 cell wall surface anchor family protein Cell wall component -1.7 (0.005) SPD_0162 membrane...”
- Transcriptional and metabolic effects of glucose on Streptococcus pneumoniae sugar metabolism
Paixão, Frontiers in microbiology 2015 - “...components 0.61 SPD_0773 PTS system, fructose specific IIABC components 0.36 SPD_1039 ptsI Phosphoenolpyruvate-protein phosphotransferase 0.49 SPD_1040 ptsH Phosphocarrier protein HPr 0.56 SPD_1047 lacE-2 PTS system, lactose-specific IIBC components 0.78 SPD_1057 PTS system, IIB component, putative 1.48 SPD_1409 Sugar ABC transporter, ATP-binding protein 0.52 SPD_1493 Sugar ABC...”
lmo1002 PTS phosphocarrier protein Hpr (histidine containing protein) from Listeria monocytogenes EGD-e
LM6179_1319 phosphocarrier protein HPr from Listeria monocytogenes 6179
33% identity, 92% coverage
- Executioner caspases degrade essential mediators of pathogen-host interactions to inhibit growth of intracellular Listeria monocytogenes
Lavergne, Cell death & disease 2025 - “...lmo0201 Invasion-associated protein p60 A0A0H3GDY4 lmo0582 Thioredoxin-like_fold domain-containing protein A0A0H3GFB7 lmo1059 Phosphocarrier protein HPr A0A0H3GFK1 lmo1002 Antigen A A0A0H3GGY8 lmo0118 Beta-lactamase domain-containing protein A0A0H3GI09 lmo0540 N-acetylmuramoyl-L-alanine amidase A0A0H3GJB3 lmo2591 DNA-directed RNA polymerase subunit alpha A0A0H3GJC8 lmo2606 Competence protein ComEA A0A0H3GKB9 lmo1484 Uncharacterized protein A0A0H3GMD3 lmo2203 Putative...”
- DegU-mediated suppression of carbohydrate uptake in Listeria monocytogenes increases adaptation to oxidative stress
Chen, Applied and environmental microbiology 2023 (secret) - Listeria monocytogenes GshF contributes to oxidative stress tolerance via regulation of the phosphoenolpyruvate-carbohydrate phosphotransferase system
Chen, Microbiology spectrum 2023 - “...lmo0915 PTS sugar transporter subunit IIC lmo0916 4.88 Yes/down lmo0916 PTS sugar transporter subunit IIA lmo1002 ptsH Phosphocarrier protein HPr lmo1003 lmo1003 Phosphotransferase system enzyme I lmo1017 1.24 Yes/down lmo1017 PTS glucose transporter subunit IIA lmo1035 lmo1035 PTS beta-glucoside transporter subunit IIABC lmo1095 3.29 Yes/down lmo1095...”
- Listeria monocytogenes PrsA2 is required for virulence factor secretion and bacterial viability within the host cell cytosol
Alonzo, Infection and immunity 2010 - “...and lmo2416 lipoproteins lmo0369 lmo1388 lmo1757 lmo2637 lmo1847 lmo1002 MreC Protein description VOL. 78, 2010 ROLE OF PrsA2 IN L. MONOCYTOGENES PATHOGENESIS...”
- Glycerol metabolism and PrfA activity in Listeria monocytogenes
Joseph, Journal of bacteriology 2008 - “...Inactivation of HPr by insertion of pLSV101 in lmo1002 In-frame deletion of lmo1167 (glycerol uptake facilitator) In-frame deletion of lmo1539 (glycerol uptake...”
- “...monocytogenes EGD-e EGD-e::hprK (lmo2483) EGD-e::ptsH (lmo1002) EGD-elmo1167 (glpF2) EGD-elmo1539 (glpF1) EGD-elmo1034 (glpK2) EGD-elmo1538 (glpK1)...”
- Interference of components of the phosphoenolpyruvate phosphotransferase system with the central virulence gene regulator PrfA of Listeria monocytogenes
Mertins, Journal of bacteriology 2007 - “...Disruption of the ccpA, hprK (lmo2483), and ptsH (lmo1002) gene in L. monocytogenes. The insertion mutants were constructed by using L. monocytogenes Sv1/2a...”
- Intracellular gene expression profile of Listeria monocytogenes
Chatterjee, Infection and immunity 2006 - “...degraded by sugar hydrolases or -glucosidases. Significantly, lmo1002, encoding a PTS phosphocarrier protein, Hpr, was down regulated inside the cytosol. The...”
- Development of a Listeria monocytogenes EGDe partial proteome reference map and comparison with the protein profiles of food isolates
Ramnath, Applied and environmental microbiology 2003 - “...Tsf (lmo1657), translation elongation factor PtsH (lmo1002), phosphotransferase system phosphocarrier protein (Hpr) Adk (lmo2611), similar to adenylate kinases...”
- Transcriptome analysis of Listeria monocytogenes exposed to biocide stress reveals a multi-system response involving cell wall synthesis, sugar uptake, and motility
Casey, Frontiers in microbiology 2014 - “...Gene Protein Fold change UPREGULATED Phosphotransferase system LM6179_1320 ptsI Phosphotransferase system (PTS) enzyme I 4.47 LM6179_1319 ptsH Histidine-containing phosphocarrier protein of the phosphotransferase system (PTS) (HPr protein) 4.33 LM6179_1334 ptsG Putative PTS system, glucose-specific, IIA component 11.72 LM6179_0306 bglP PTS system beta-glucoside-specific EIIBCA component 27.79 LM6179_0618...”
PTFAX_XANCP / P45597 Multiphosphoryl transfer protein; MTP; Triphosphoryl transfer protein; TTP; EC 2.7.3.9 from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
40% identity, 10% coverage
- function: The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The enzyme II FruAB PTS system is involved in fructose transport.
catalytic activity: L-histidyl-[protein] + phosphoenolpyruvate = N(pros)-phospho- L-histidyl-[protein] + pyruvate (RHEA:23880)
cofactor: Mg(2+)
disruption phenotype: Cells lacking this gene grow normally on glucose but are unable to grow on fructose, mannose, mannitol or sucrose. - The Pfam protein families database.
Bateman, Nucleic acids research 2000
AB6M95_07010 phosphoenolpyruvate--protein phosphotransferase from Pseudodesulfovibrio karagichevae
42% identity, 9% coverage
AHA_4006 PTS-dependent dihydroxyacetone kinase, phosphotransferase subunit DhaM from Aeromonas hydrophila subsp. hydrophila ATCC 7966
37% identity, 34% coverage
- Quantitative proteomics analysis reveals an important role of the transcriptional regulator UidR in the bacterial biofilm formation of Aeromonas hydrophila
Li, Frontiers in cellular and infection microbiology 2024 - “...and eight DEPs ( gldA , AHA_2461 , AHA_2460 , glpC , AHA_1652 , glpK, AHA_4006 , dhaK ) were enriched in propanoate metabolism (FDR=0.0355). Interestingly, there were still a series of proteins with similar functions showing significant differences in some pathways which had no different...”
- Transcriptome differences between enrofloxacin-resistant and enrofloxacin-susceptible strains of Aeromonas hydrophila
Zhu, PloS one 2017 - “...AHA_4201 (carbon-nitrogen lyase activity). The biological process-related genes such as AHA_1213, AHA_1652 (glycerol metabolic process), AHA_4006 (alditol metabolic process), AHA_1921, and AHA_2046 (endoplasmic reticulum) were downregulated. The functions of the hypothetical proteins were not clear, but were closely related to the biological functions of organisms. (...”
phbH / AAA21977.1 protein H from Cupriavidus necator (see paper)
H16_A0325 Phosphocarrier protein (HPr) from Ralstonia eutropha H16
35% identity, 92% coverage
Rmet_0245 HPrNtr from Ralstonia metallidurans CH34
35% identity, 92% coverage
M5005_Spy_1121 phosphocarrier protein HPr from Streptococcus pyogenes MGAS5005
45% identity, 77% coverage
Reut_A0296 Phosphoryl transfer system, HPr from Ralstonia eutropha JMP134
35% identity, 92% coverage
XOO2810 multiphosphoryl transfer protein from Xanthomonas oryzae pv. oryzae KACC10331
40% identity, 9% coverage
MNF30_01490 HPr family phosphocarrier protein from Mycoplasma mycoides subsp. capri
38% identity, 85% coverage
SAOUHSC_01028 phosphocarrier protein hpr, putative from Staphylococcus aureus subsp. aureus NCTC 8325
P99143 Phosphocarrier protein HPr from Staphylococcus aureus (strain N315)
SA0934 phophocarrier protein HPR, phosphohistidin-containing protein from Staphylococcus aureus subsp. aureus N315
SAV1083 phophocarrier protein Hpr from Staphylococcus aureus subsp. aureus Mu50
SAUSA300_0983 phosphocarrier protein HPr from Staphylococcus aureus subsp. aureus USA300_FPR3757
SACOL1091 phosphocarrier protein HPr from Staphylococcus aureus subsp. aureus COL
34% identity, 94% coverage
- Genome-wide screen for genes involved in eDNA release during biofilm formation by Staphylococcus aureus
DeFrancesco, Proceedings of the National Academy of Sciences of the United States of America 2017 - “...Gene Product Log2-FC SAOUHSC_01354 SAOUHSC_01028 SAOUHSC_01029 SAOUHSC_00420 SAOUHSC_00880 SAOUHSC_02699 SAOUHSC_00670 SAOUHSC_03037 SAOUHSC_00636 SAOUHSC_01979...”
- Genomic Signatures of Experimental Adaptation to Antimicrobial Peptides in Staphylococcus aureus
Johnston, G3 (Bethesda, Md.) 2016 (no snippet) - A new platform for ultra-high density Staphylococcus aureus transposon libraries
Santiago, BMC genomics 2015 - “...with nine of the remainder found to be domain essential as at 30C. One gene, SAOUHSC_01028, encoding the phosphor-carrier HPr was found to be non-essential at 43C. Transposon insertions in domain essential genes are likely to result in cells that are weak and/or have growth defects,...”
- Identification of N-terminal protein processing sites by chemical labeling mass spectrometry
Misal, Rapid communications in mass spectrometry : RCM 2019 - “...10 M PIVNVKLLEGR S P99132 Probable tautomerase SA1195.1 Cytoplasm 16 16 11 - MEQNSYVIIDETGIHAR P P99143 Phosphocarrier protein HPr Cytoplasm 121 9 12 M EQNSYVIIDETGIHAR P P99143 Phosphocarrier protein HPr Cytoplasm 19 12 13 M ATISAKLVKELR K P99171 Elongation factor Ts Cytoplasm 2 2 14 M...”
- Characterizing the effects of inorganic acid and alkaline shock on the Staphylococcus aureus transcriptome and messenger RNA turnover
Anderson, FEMS immunology and medical microbiology 2010 - “...ND SA0864 hypothetical protein sa_c8581s7540_a_at 3.0 2.5 2.5 SA0930 hypothetical protein sa_c8595s7551_at 4.1 2.5 2.5 SA0934 hypothetical protein sa_c8086s7067_a_at 2.3 2.5 2.5 SA0939 hypothetical protein sa_c8693s7642_a_at 3.9 2.5 2.5 SA0967 hypothetical protein sa_c429s262_a_at * 5.6 2.5 2.5 SA1017 hypothetical protein sa_c439s269_a_at 3.8 2.5 2.5 SA1019 hypothetical...”
- Characterizing the effect of the Staphylococcus aureus virulence factor regulator, SarA, on log-phase mRNA half-lives
Roberts, Journal of bacteriology 2006 - “...15 15 5 5 5 5 SA0934 SA0729 SA0528 SA2053 Enolase Fructose-bisphosphate aldolase Fructose-bisphosphate aldolase homolog Glyceraldehyde-3-phosphate dehydrogenase...”
- Two novel point mutations in clinical Staphylococcus aureus reduce linezolid susceptibility and switch on the stringent response to promote persistent infection
Gao, PLoS pathogens 2010 - “...protein, Opp3A 6.06 SAV0994 oligopeptide transport system permease 3.19 SAV1023 htrA Serine protease HtrA 3.34 SAV1083 argJ bifunctional ornithine acetyltransferase/N-acetylglutamate synthase, ArgJ 2.61 SAV1085 ornithine aminotransferase 2.69 SAV2053 ilvD dihydroxy-acid dehydratase 6.03 SAV2054 ilvB acetolactate synthase large subunit 4.54 SAV2057 leuA 2-isopropylmalate synthase 7.07 SAV2058 leuB...”
- Usnic acid modifies MRSA drug resistance through down-regulation of proteins involved in peptidoglycan and fatty acid biosynthesis
Sinha, FEBS open bio 2019 - “...U12 Peroxide responsive repressor (PerR) Q7A4T8 perR 17183 4 0.37 114 0.003 U13 UPF0413 protein SAUSA300_0983 Q2FI75 SAUSA300_0903 31364 12 0.29 328 0.004 U14 Putative 2hydroxyacid dehydrogenase SAR2389 Q6GEC9 SAR2389 34675 15 0.15 175 0.004 D1 Fructosebisphosphate aldolase Class I P99117 fda 32913 13 1.37 266...”
- Virulence and Metabolism
Richardson, Microbiology spectrum 2019 (secret) - Staphylococcus aureus CcpA affects virulence determinant production and antibiotic resistance
Seidl, Antimicrobial agents and chemotherapy 2006 - “...of B. subtilis (38), and the presence of HPr (SaCOL1091), HPrK (SaCOL0825), and CcpA (SaCOL1786) homologues in S. aureus suggest that a similar mechanism might...”
STER_1243, STER_RS06135, T303_07270 phosphocarrier protein HPr from Streptococcus thermophilus ASCC 1275
45% identity, 77% coverage
- Cell Proteins Obtained by Peptic Shaving of Two Phenotypically Different Strains of Streptococcus thermophilus as a Source of Anti-Inflammatory Peptides
Allouche, Nutrients 2022 - “...69.61 Carbohydrate metabolism and transport STER_0684|ID:1899266|eno| STER_RS03365 Enolase 46.95 CS/M/Cyto 10 22.30 8 19.08 STER_1243|ID:1900052| STER_RS06135 Phosphocarrier protein HPr (histidine-containing protein) 8.91 Cyto 35 98.86 17 98.86 STER_1876|ID:1900541|kbaY| STER_RS09185 Tagatose 6-phosphate aldolase 1, kbaY subunit 31.51 Cyto 10 31.63 8 30.27 Cell wall/membrane/envelope biogenesis STER_0042|ID:1898743| STER_RS00210...”
- “...Ribosomal protein L24 (BL23) 10.86 Cyto 16 69.61 21 80.39 Carbohydrate metabolism and transport STER_1243|ID:1900052| STER_RS06135 Phosphocarrier protein HPr (Histidine-containing protein) 8.91 Cyto 11 60.23 19 98.86 STER_0684|ID:1899266|eno| STER_RS03365 Enolase 46.95 CS/M/Cyto 9 26.44 Unknown or other function STER_0856|ID:1899377| STER_RS04220 CD4+ T-cell-stimulating antigen precursor 37.62 CS...”
- Functional Genomic Analyses of Exopolysaccharide-Producing Streptococcus thermophilus ASCC 1275 in Response to Milk Fermentation Conditions
Wu, Frontiers in microbiology 2019 - “...change again under Cd4, suggesting an enhanced fatty acid biosynthesis. The up-regulation of phosphocarrier protein (T303_07270, 3.16-fold) did not provide actual evidence for the enhanced phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) since lactose is transported by LacS permease in ST1275 ( Wu et al., 2014 ). Other...”
- Identification of Hanks-Type Kinase PknB-Specific Targets in the Streptococcus thermophilus Phosphoproteome
Henry, Frontiers in microbiology 2019 - “...STER_RS06065 PtsI Phosphoenolpyruvate protein phosphotransferase YP_820626.1 WP_011681297.1 STER_1242 STER_RS06130 PtsH Phosphocarrier protein HPr YP_820627.1 WP_002946351.1 STER_1243 STER_RS06135 Ldh L -lactate dehydrogenase YP_820638.1 WP_011226177.1 STER_1257 STER_RS06205 GapA1 Glyceraldehyde 3-phosphate dehydrogenase YP_821096.1 WP_011681649.1 STER_1761 STER_RS08615 Fba Fructose/tagatose biphosphate aldolase YP_821189.1 WP_011681711.1 STER_1876 STER_RS09185 LacZ Beta-galactosidase YP_820735.1 WP_011226267.1 STER_1366...”
- “...PtsI Phosphoenolpyruvate protein phosphotransferase YP_820626.1 WP_011681297.1 STER_1242 STER_RS06130 PtsH Phosphocarrier protein HPr YP_820627.1 WP_002946351.1 STER_1243 STER_RS06135 Ldh L -lactate dehydrogenase YP_820638.1 WP_011226177.1 STER_1257 STER_RS06205 GapA1 Glyceraldehyde 3-phosphate dehydrogenase YP_821096.1 WP_011681649.1 STER_1761 STER_RS08615 Fba Fructose/tagatose biphosphate aldolase YP_821189.1 WP_011681711.1 STER_1876 STER_RS09185 LacZ Beta-galactosidase YP_820735.1 WP_011226267.1 STER_1366 STER_RS06725...”
PXO_RS08655 phosphoenolpyruvate--protein phosphotransferase from Xanthomonas oryzae pv. oryzae PXO99A
40% identity, 10% coverage
Pcar_1930 phosphocarrier protein HPr from Pelobacter carbinolicus str. DSM 2380
38% identity, 85% coverage
GJQ69_00905 HPr family phosphocarrier protein from Caproicibacterium lactatifermentans
41% identity, 84% coverage
- Revealing the Characteristics of Glucose- and Lactate-Based Chain Elongation for Caproate Production by Caproicibacterium lactatifermentans through Transcriptomic, Bioenergetic, and Regulatory Analyses
Wang, mSystems 2022 - “...phosphotransferase system (PTS)-encoding genes (GJQ69_00890, GJQ69_00895, GJQ69_00900, and GJQ69_01220) and a phosphocarrier protein (HPr)-encoding gene (GJQ69_00905) were significantly upregulated with glucose as carbon source, suggesting that glucose was taken up by PTS rather than ATP-binding cassette (ABC) transporter in C. lactatifermentans ( Fig.3 ). Although the...”
- “...consists of genes encoding PTS enzyme II (GJQ69_00895, GJQ69_00900) and a phosphoryl carrier protein (HPr, GJQ69_00905) ( Fig.9A ). Genes GJQ69_00895 and GJQ69_00900 encode PTS subunits IIA and IIBC, respectively, both of which showed more than 4-fold increased expression under glucose conditions ( Data set S1...”
SSA_0772 Histidine-containing phosphocarrier protein of the PTS, putative from Streptococcus sanguinis SK36
45% identity, 77% coverage
- Involvement of signal peptidase I in Streptococcus sanguinis biofilm formation
Aynapudi, Microbiology (Reading, England) 2017 - “...phosphoglycerate mutase No SSA_0859 7.75 62.77 Triosephosphate isomerase No SSA_0813 9.7 11.04 Thioredoxin reductase No SSA_0772 9.91 75.4 PTS family porter, phosphocarrier protein HPR No SSA_0878 11.11 16.27 DNA gyrase subunit B No SSA_1896 11.8 32.13 Translation initiation factor IF-2 No SSA_1043 12.99 5.47 Homoserine dehydrogenase...”
B7HN27 Phosphocarrier protein HPr from Bacillus cereus (strain AH187)
39% identity, 77% coverage
NMCC_0141 sugar transport PTS system phosphocarrier protein HPR from Neisseria meningitidis 053442
34% identity, 93% coverage
DQM59_RS07180, SMU_674 phosphocarrier protein HPr from Streptococcus mutans
43% identity, 77% coverage
- Adaptation to simulated microgravity in Streptococcus mutans
Fernander, NPJ microgravity 2022 - “...role for this variant in simulated microgravity. There was also a new shared variant in DQM59_RS07180, ptsH (phosphocarrier protein HPr), that was observed at low frequency in two normal gravity replicates and at high frequency (with one sweep f =1.000) in the simulated microgravity (Table 1...”
- “...has been associated with this type of environment. Two simulated microgravity populations also held ptsH (SMU_674) mutations by day 42, these became high frequency variants by 63 days when intermediate frequency variants were first detected in two normal gravity populations. By 100-days there was a single...”
VSAL_II0090 PTS system, fructose-specific IIA/FPR component from Vibrio salmonicida LFI1238
VSAL_II0090 fused PTS fructose transporter subunit IIA/HPr protein from Aliivibrio salmonicida LFI1238
44% identity, 21% coverage
VPA0813 PTS system, fructose-specific IIA/FPR component from Vibrio parahaemolyticus RIMD 2210633
42% identity, 20% coverage
WU75_14970 fused PTS fructose transporter subunit IIA/HPr protein from Vibrio parahaemolyticus
42% identity, 20% coverage
WP_010370017 phosphocarrier protein HPr from Weissella cibaria
41% identity, 78% coverage
Tfu_2487 phosphoryl transfer system, HPr from Thermobifida fusca YX
35% identity, 92% coverage
- Systematic analysis of an evolved Thermobifida fusca muC producing malic acid on organic and inorganic nitrogen sources
Deng, Scientific reports 2016 - “...the transcriptions of the genes related to carbohydrate metabolisms significantly more than yeast extract. Importantly, Tfu_2487 , encoding histidine-containing protein (HPr), didnt transcribe on yeast extract at all, while it transcribed highly on ammonium sulfate. In order to understand the impact of HPr on malate production...”
- “...with addition of ammonium sulfate and yeast extract, respectively. The histidine phosphocarrier protein (Hpr or Tfu_2487) didnt express at all in the muC strain on ammonium sulfate, with faster cell growth and less malic acid yield compared to the one on yeast extract. In order to...”
NGK_2199 PtsH from Neisseria gonorrhoeae NCCP11945
NGO2037 PtsH from Neisseria gonorrhoeae FA 1090
34% identity, 93% coverage
- Antimicrobial resistance genetic factor identification from whole-genome sequence data using deep feature selection
Shi, BMC bioinformatics 2019 - “...0.506 intergenic between NGK_0295 and NGK_0296 5075 0.497 NGK_0295 glutathione synthetase 34282 0.483 intergenic between NGK_2199 and NGK_2200 33843 0.482 NGK_2182 putative integral membrane protein 20553 0.478 NGK_1395 OTB_PSEPK Probable sugar efflux transporter 2285 0.477 NGK_0116 conserved hypothetical protein 34301 0.475 NGK_2201 hypoxanthine-guanine phosphoribosyltransferase 16353 0.447...”
- Dinner date: Neisseria gonorrhoeae central carbon metabolism and pathogenesis
Potter, Emerging topics in life sciences 2024 - “...Cytochrome bc 1 NGO2029-2031 NEIS2034-NEIS2032 pta Phosphate Acyltransferase NGO0214 NEIS0575 ptsH PTS Histidine-Containing Phosphocarrier (HPr) NGO2037 NEIS2025 ptsI PTS Enzyme I NGO2038 NEIS2024 ptsL PTS Enzyme IIA NGO2036 NEIS2026 pyk Pyruvate Kinase NGO1881 NEIS0074 sdhBADC Succinate Dehydrogenase NGO0920-0923 NEIS0928- NEIS0925 Table 2. Glossary of Abbreviations used...”
XC_1305 phosphotransferase system HPr enzyme from Xanthomonas campestris pv. campestris str. 8004
34% identity, 90% coverage
- HprKXcc is a serine kinase that regulates virulence in the Gram-negative phytopathogen Xanthomonas campestris
Li, Environmental microbiology 2019 - “...of genes encoding homologues of the PTS proteins, including Enzyme I (PtsI, XC_1304), HPr (PtsH, XC_1305) and two EIIAlike proteins EIIA Man (PtsN Man , XC_1306) and EIIA Ntr (PtsN Ntr , XC_1309). Interestingly, the cluster also encodes an PtsH (HPr) (Ser) kinase homologue (XC_1308, herein...”
- “...putative PTSrelated genes in Xcc , deletion mutants of ptsI ( XC_1304 ), ptsH ( XC_1305 ), ptsN Man ( XC1306 ), ptsN Ntr ( XC_1309 ) and hprK Xcc ( XC_1308 ) were constructed by using the suicide vector pK18mob sacB (see Methods) and the...”
P23388 Multiphosphoryl transfer protein from Rhodobacter capsulatus
46% identity, 8% coverage
CC0448 PTS system, fructose-specific EIIA/HPr/EI components from Caulobacter crescentus CB15
33% identity, 9% coverage
L21SP2_3294 HPr family phosphocarrier protein from Salinispira pacifica
36% identity, 92% coverage
PTHP_BACTI / Q9F166 Phosphocarrier protein HPr from Bacillus thuringiensis subsp. israelensis (see 2 papers)
BC4049 Phosphocarrier protein HPr from Bacillus cereus ATCC 14579
BAS3959 phosphocarrier protein HPr from Bacillus anthracis str. Sterne
BC_4049, BTF1_18560 phosphocarrier protein HPr from Bacillus thuringiensis HD-789
37% identity, 77% coverage
- function: General (non sugar-specific) component of the phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS). This major carbohydrate active-transport system catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The phosphoryl group from phosphoenolpyruvate (PEP) is transferred to the phosphoryl carrier protein HPr by enzyme I. Phospho-HPr then transfers it to the PTS EIIA domain
function: P-Ser-HPr interacts with the catabolite control protein A (CcpA), forming a complex that binds to DNA at the catabolite response elements cre, operator sites preceding a large number of catabolite- regulated genes. Thus, P-Ser-HPr is a corepressor in carbon catabolite repression (CCR), a mechanism that allows bacteria to coordinate and optimize the utilization of available carbon sources. P-Ser-HPr mediates glucose catabolite repression of cry4A toxin expression - Microwave supported hydrolysis prepares Bacillus spores for proteomic analysis
Chen, International journal of mass spectrometry 2019 - “...P39579 D-alanyl carrier protein 3955.6 3955.2 QLEALSPLKVMmRGYGLVYSEKNQVLKSVKDVSAGD A7GSJ8 Exodeoxyribonuclease 7 large subunit 2062.3 2062.8 DAAQALAAIEETMKNEGLGE Q9F166 Phosphocarrier protein HPr 4980.6 4981.1 NAGHRGAVTIATNMAGRGTDIKLGEGVRELGGLHVLGTERHESRRID Q9K6W8 Protein translocase subunit SecA 2507.8 2507.8 NAQAYVTDVKVSEPTKLTLTGTGL P94217 S-layer protein EA1 1542.7 1542.5 GVVNYGSKLSGKDFA P94217 S-layer protein EA1 1863.1 1863.5 PENLEGYEVESKNLAVA P94217 S-layer...”
- Methionine Residues in Exoproteins and Their Recycling by Methionine Sulfoxide Reductase AB Serve as an Antioxidant Strategy in Bacillus cereus
Madeira, Frontiers in microbiology 2017 - “...Gene no . Protein name Protein description Log 2 fold-change EE LE S Metabolism NP_833767 BC4049 HPr Phosphocarrier protein HPr 2.24 Carbohydrate NP_834306 BC4600 Pfk 6-phosphofructokinase 3.09 NP_833689 BC3970 PdhD Dihydrolipoamide dehydrogenase 2.43 NA BC5138 Pgk Phosphoglycerate kinase 1.79 NP_834571 BC4898 Pgi Glucose-6-phosphate isomerase 2.30 NP_833346...”
- Assessment of CcpA-mediated catabolite control of gene expression in Bacillus cereus ATCC 14579
van, BMC microbiology 2008 - “...system, glucose-specific IIABC component BC4050 RZC06596 0.52 1.12 2 ptsH # 2 Phosphocarrier protein HPr BC4049 RZC00081 0.56 1.10 + ptsI # 3 Phosphoenolpyruvate-protein phosphotransferase BC4048 RZC06595 0.66 1.16 1 pgi Glucose-6-phosphate isomerase BC4898 RZC03793 0.31 0.20 1 pfkA 1 6-phosphofructokinase BC4600 RZC02283 0.45 0.47 -...”
- Glucose-dependent activation of Bacillus anthracis toxin gene expression and virulence requires the carbon catabolite protein CcpA
Chiang, Journal of bacteriology 2011 - “...the N-terminal His-tagged HPr protein, the ptsH gene (BAS3959) was amplified by PCR using oligonucleotide primers BAptsH5Nde and BAptsH3Xho. The fragment was...”
- NagRBt Is a Pleiotropic and Dual Transcriptional Regulator in Bacillus thuringiensis
Cao, Frontiers in microbiology 2018 - “...rather than repress them. Glucose-specific phosphotransferase enzyme IIA (BTF1_24980), phosphoenolpyruvate-protein phosphotransferase (BTF1_18555), phosphocarrier protein HPr (BTF1_18560), and the PTS lactose cellobiose family IIC subunit (BTF1_24425) involved in the phosphotransferase system showed enhanced expression as previously reported in S. coelicolor (Rigali et al., 2004 , 2006 )....”
- “...36 atacatctagacaact 12.76 6.679 3.551 0.270 BTF1_18555 ptsI Phosphoenolpyruvate-protein phosphotransferase / / / 6.284 NT BTF1_18560 ptsH Phosphocarrier protein HPr 52 agttgtatagacgtga 9.82 6.395 4.716 0.299 BTF1_18585 nagB Glucosamine-6-phosphate deaminase / / / 11.365 NT BTF1_18590 nagA N-acetylglucosamine-6-phosphate deacetylase 90 gcacgagtagttgtct 8.05 21.012 36.413 1.955 BTF1_19070...”
- Proteomic evidences for rex regulation of metabolism in toxin-producing Bacillus cereus ATCC 14579
Laouami, PloS one 2014 - “...0,00 1,32 0,054 FbA BC_5335 NP_834997 Fructose-bisphosphate aldolase N N 0,76 0,298 3,6 0,03 Hpr BC_4049 NP_833767 Phosphocarrier protein HPr N N 2,4 0,03 1,18 0,079 Bdh BC_0868 NP_830481 (R,R)-butanediol dehydrogenase N N 3,32 0,06 3,6 0,02 PtsA BC_4048 NP_833766 Phosphotransferase N N 2,12 0,058 3,2...”
Ethha_0719 HPr family phosphocarrier protein from Ethanoligenens harbinense YUAN-3
42% identity, 79% coverage
LF82_722 phosphoenolpyruvate--protein phosphotransferase from Escherichia coli LF82
39% identity, 9% coverage
MPN053 phosphocarrier protein HPr from Mycoplasma pneumoniae M129
37% identity, 84% coverage
RD2015_RS22180 HPr family phosphocarrier protein from Roseateles depolymerans
35% identity, 91% coverage
Q83DI7 Phosphocarrier protein HPr from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
35% identity, 91% coverage
- Quantitative proteome profiling of C. burnetii under tetracycline stress conditions
Vranakis, PloS one 2012 - “...detoxification (Q83AQ8), threonine catabolic process (Q83F39), purine ribonucleoside salvage (Q83FC4), transport and binding (Q83BF9, Q82OW5, Q83DI7 and Q83AW2) and unknown function (B5QSC3, B5QSC0, Q83A96, Q83EA1, Q83EJ9, Q83A79, Q83D04, Q83DR4, Q83B41 and Q83CL9). One example of the latter is ScvA (B5QSC0), a highly basic DNA binding protein...”
NMB2045 phosphocarrier protein HPr from Neisseria meningitidis MC58
33% identity, 91% coverage
- The Phosphocarrier Protein HPr Contributes to Meningococcal Survival during Infection
Antunes, PloS one 2016 - “...possesses the general enzymes of the PTS system, the EI (NMB2044) as well as HPr (NMB2045) and two EIIA components, one of the mannose and the other of the fructose PTS family (NMB2046 and NMB0736, respectively). However, the PTS of meningococcus is incomplete because it lacks...”
- “...Origin MC58 Nm laboratory-adapted reference strain, sequenced strain Ref [ 24 ] MC58 ptsH ptsH (NMB2045) deletion mutant of MC58, kan R This study MC58 ptsH-C MC58 ptsH complemented with ptsH , kan R , Spec R This study MC58 lux MC58 strain, in wich PporB-luxCDABE-aph3...”
- Crystal structure of nitrogen regulatory protein IIANtr from Neisseria meningitidis
Ren, BMC structural biology 2005 - “...gene (NMB0217, which may not be functional) nor is it close to the HPr-like protein (NMB2045). The structures of the E. coli IIA Ntr [ 9 ] and related IIA mannitol (IIA mtl ) domain of PTS [ 10 ] have been solved by X-ray crystallography....”
- “...Interestingly in Neisseria meningitidis , there is only one HPr-like protein, encoded by the gene NMB2045. The N. meningitidis HPr-like protein (abbreviated to NM-HPr) shares 32% and 38% sequence identity with E. coli HPr and NPr respectively. Insight into how IIA proteins bind to the upstream...”
- CcpA-dependent carbon catabolite repression in bacteria
Warner, Microbiology and molecular biology reviews : MMBR 2003 - “...RRUBP475 MAGNP76 PTHP PSTH REUTP495f NEURP196 BCEPP510 NMB2045 PTHP PA4466 PFLUP387 PTSO MDEGP161 AVINP175 PTSH 13474414 13474245 15963793 15887388 17988314...”
MHJ_0611 phosphocarrier protein HPr from Mycoplasma hyopneumoniae J
38% identity, 80% coverage
- N-terminomics identifies widespread endoproteolysis and novel methionine excision in a genome-reduced bacterial pathogen
Berry, Scientific reports 2017 - “...Putative aminopeptidase (M)SILEKMKKYCDIDGMSR MHJ_0080 Purine-nucleoside phosphorylase (M)TAHIEAKKNEIAPIVLMPGDPLR MHJ_0506 Phosphate acetyltransferase (M)TYQEYLQAR MHJ_0110 Adenine phosphoribosyltransferase (M)QINLEKYIR MHJ_0611 Phosphocarrier protein HPr (M)VSFSAVVIDKLGFHAR We interrogated the remaining N-terminal data for any sequences which represent possible alternative translation initiation sites (aTIS) or incorrectly annotated ORFs. We identified sequences with methionine...”
- “...MHJ_0617 DNA-directed RNA polymerase subunit beta 4 MHJ_0067 Bacterial nucleoid DNA-binding protein 1 NC Transporter MHJ_0611 Phosphocarrier protein HPr 1 MHJ_0469 Phosphoenolpyruvate-protein phosphotransferase 2 Membrane MHJ_0227 Periplasmic sugar-binding protein 1 NC Protein Folding MHJ_0524 Elongation factor Tu 26 MHJ_0071 Elongation factor G 3 MHJ_0064 Chaperone protein...”
NE2184 Phosphocarrier HPr protein from Nitrosomonas europaea ATCC 19718
37% identity, 91% coverage
FN1782 Phosphocarrier protein HPr from Fusobacterium nucleatum subsp. nucleatum ATCC 25586
37% identity, 85% coverage
LEPBI_I1652 phosphocarrier protein HPr (histidine-containing protein) from Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'
39% identity, 78% coverage
- The sigma factor σ54 is required for the long-term survival of Leptospira biflexa in water
Zhang, Molecular microbiology 2018 - “...signal peptide No hit No hit LEPBI_I2502 2.25 - Hypothetical protein No hit No hit LEPBI_I1652 2.21 COG1925G Phosphocarrier protein HPr (histidine-containing protein) LA_2402 LBL_1668 LEPBI_I1653 2.20 COG5000T Histidine kinase sensor protein; putative membrane protein LA_2401 LBL_1667 LEPBI_II0220 2.17 - Hypothetical protein LA_2746, LA_4046 LBL_1948, LBL_2853...”
A8AYH5 Phosphocarrier protein HPr from Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
SGO_1556 phosphocarrier protein HPr from Streptococcus gordonii str. Challis substr. CH1
SGO_RS07625 phosphocarrier protein HPr from Streptococcus gordonii str. Challis substr. CH1
42% identity, 74% coverage
- Intracellular Ser/Thr/Tyr phosphoproteome of the oral commensal Streptococcus gordonii DL1
Robertsson, BMC microbiology 2020 - “...A8AXW3 6.7/6.25 23,000/26325 1124 18 72% Sugar transport HPr a) Phosphocarrier protein HPr ptsH (SGO_1556) A8AYH5 5.1/4.74 11,000/8935 124 2 55% + Glycolysis Tpi-1 a) Triosephosphateisomerase tpiA(SGO_0762) A8AWA1 4.5/4.75 23,000/26524 652 9 52% + Tpi-2 a) 4.3/4.75 23,000/26524 540 9 52% - pfk-1 a) Phosphofructokinase pfkA(SGO_1340)...”
- Intracellular Ser/Thr/Tyr phosphoproteome of the oral commensal Streptococcus gordonii DL1
Robertsson, BMC microbiology 2020 - “...SGO_1342 A8AXW3 6.7/6.25 23,000/26325 1124 18 72% Sugar transport HPr a) Phosphocarrier protein HPr ptsH (SGO_1556) A8AYH5 5.1/4.74 11,000/8935 124 2 55% + Glycolysis Tpi-1 a) Triosephosphateisomerase tpiA(SGO_0762) A8AWA1 4.5/4.75 23,000/26524 652 9 52% + Tpi-2 a) 4.3/4.75 23,000/26524 540 9 52% - pfk-1 a) Phosphofructokinase...”
- Interactions Between Streptococcus gordonii and Fusobacterium nucleatum Altered Bacterial Transcriptional Profiling and Attenuated the Immune Responses of Macrophages
Liu, Frontiers in cellular and infection microbiology 2021 - “...(EII) complexes ( Postma etal., 1993 ; Tong etal., 2011 ). The S. gordonii gene (SGO_RS07625) that encodes HPr was up-regulated with a fold change of 2.41 in response to S. gordonii - F. nucleatum subsp . polymorphum coaggregation. Seven more genes encoding PTS cellobiose/mannose/beta-glucoside transporter...”
HVO_2101 phosphocarrier protein HPr from Haloferax volcanii DS2
38% identity, 82% coverage
- Carbohydrate metabolism in Archaea: current insights into unusual enzymes and pathways and their regulation
Bräsen, Microbiology and molecular biology reviews : MMBR 2014 - “...PTS gene cluster, missing only the EI gene (HVO_2101 to HVO_2104), was identified downstream of the gene encoding triosephosphate isomerase in Hfx. volcanii....”
- Fructose degradation in the haloarchaeon Haloferax volcanii involves a bacterial type phosphoenolpyruvate-dependent phosphotransferase system, fructose-1-phosphate kinase, and class II fructose-1,6-bisphosphate aldolase
Pickl, Journal of bacteriology 2012 - “...described here, H. volcanii contains a second, incomplete PTS (HVO_2101 to HVO_2104) missing the EI component, the function of which is not known (26). Further,...”
PTFAH_SALTY / P17127 Multiphosphoryl transfer protein; MTP; Diphosphoryl transfer protein; DTP; Phosphotransferase FPr protein; Pseudo-HPr from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
STM2206 phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 from Salmonella typhimurium LT2
t0650 fructose-specific IIA/FPR component of PTS system from Salmonella enterica subsp. enterica serovar Typhi Ty2
T_RS03285 fused PTS fructose transporter subunit IIA/HPr protein from Salmonella enterica subsp. enterica serovar Typhi str. Ty2
37% identity, 19% coverage
- function: The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The enzyme II FruAB PTS system is involved in fructose transport.
- N-dodecanoyl-homoserine lactone influences the levels of thiol and proteins related to oxidation-reduction process in Salmonella
de, PloS one 2018 - “...crr Transport -0.304 0.841 -2.267 3.151 -1.073 1.822 -0.399 1.485 0.063 0.257 Multiphosphoryl transfer protein P17127 fruB Transport ND ND -7.368 1.542 ND ND ND ND ND ND Phosphocarrier protein HPr P0AA07 ptsH Transport 8.437 1.230 7.848 3.151 0.504 0.481 1.948 0.711 -9.520 0.737 Glutamine high-affinity...”
- Stress response, amino acid biosynthesis and pathogenesis genes expressed in Salmonella enterica colonizing tomato shoot and root surfaces
Han, Heliyon 2020 - “...1.4 0.002 - serA STM3062 D-3-phosphoglycerate dehydrogenase 1.2 0.004 [G] Carbohydrate transport and metabolism fruF STM2206 bifunctional PTS system fructose-specific transporter subunit IIA HPr protein 1.0 0.006 - ydeA STM1522 sugar efflux transporter 1.1 0.003 - yicI STM3749 -xylosidase 1.1 0.005 STM2757 STM2757 cytoplasmic protein 1.1...”
- Effects of indole on drug resistance and virulence of Salmonella enterica serovar Typhimurium revealed by genome-wide analyses
Nikaido, Gut pathogens 2012 - “...gene cluster 4.0 5.3 STM2106 wcaI Putative glycosyl transferase in colanic acid biosynthesis 4.6 34 STM2206 fruF Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 4.6 12 STM3028 stdB Putative outer membrane usher protein 6.5 6.5 STM3444 bfd Regulatory or redox component complexing with Bfr, in iron storage...”
- Salmonella Typhi Colonization Provokes Extensive Transcriptional Changes Aimed at Evading Host Mucosal Immune Defense During Early Infection of Human Intestinal Tissue
Nickerson, EBioMedicine 2018 - “...Glucose-1-phosphate cytidylyltransferase T_RS19190 t3772 2.67 0.0004 Xanthine permease T_RS03270 t0646 2.6 0.0039 Membrane protein T_RS03285 t0650 2.59 0.0004 Phosphoenolpyruvate dependent, sugar transporting phosphotransferase system. T_RS03290 t0649 2.59 0.0004 Phosphofructokinase T_RS02365 t0466 2.58 0.0004 Acyltransferase T_RS10080 T_RS10080 2.57 0.0011 Hypothetical protein T_RS10085 t1980 2.57 0.0011 Translation initiation...”
- Salmonella Typhi Colonization Provokes Extensive Transcriptional Changes Aimed at Evading Host Mucosal Immune Defense During Early Infection of Human Intestinal Tissue
Nickerson, EBioMedicine 2018 - “...0.0004 Glucose-1-phosphate cytidylyltransferase T_RS19190 t3772 2.67 0.0004 Xanthine permease T_RS03270 t0646 2.6 0.0039 Membrane protein T_RS03285 t0650 2.59 0.0004 Phosphoenolpyruvate dependent, sugar transporting phosphotransferase system. T_RS03290 t0649 2.59 0.0004 Phosphofructokinase T_RS02365 t0466 2.58 0.0004 Acyltransferase T_RS10080 T_RS10080 2.57 0.0011 Hypothetical protein T_RS10085 t1980 2.57 0.0011 Translation...”
DHAM_PROSM / P0DN88 PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM; Dihydroxyacetone kinase subunit M; EC 2.7.1.121 from Providencia stuartii (strain MRSN 2154) (see 2 papers)
41% identity, 13% coverage
- function: Component of the dihydroxyacetone kinase complex, which is responsible for the phosphoenolpyruvate (PEP)-dependent phosphorylation of dihydroxyacetone. DhaM serves as the phosphoryl donor. Is phosphorylated by phosphoenolpyruvate in an EI- and HPr-dependent reaction, and a phosphorelay system on histidine residues finally leads to phosphoryl transfer to DhaL and dihydroxyacetone.
catalytic activity: dihydroxyacetone + phosphoenolpyruvate = dihydroxyacetone phosphate + pyruvate (RHEA:18381)
subunit: Homodimer. The dihydroxyacetone kinase complex is composed of a homodimer of DhaM, a homodimer of DhaK and the subunit DhaL.
Z3427 PTS system, fructose-specific IIA/fpr component from Escherichia coli O157:H7 EDL933
36% identity, 20% coverage
FruB / b2169 fructose-specific PTS multiphosphoryl transfer protein FruB from Escherichia coli K-12 substr. MG1655 (see 4 papers)
FruB / P69811 fructose-specific PTS multiphosphoryl transfer protein FruB from Escherichia coli (strain K12) (see 2 papers)
PTFAH_ECOLI / P69811 Multiphosphoryl transfer protein; MTP; Diphosphoryl transfer protein; DTP; Phosphotransferase FPr protein; Pseudo-HPr from Escherichia coli (strain K12) (see paper)
TC 4.A.2.1.1 / P69811 PTFA aka FRUB aka FRUF aka FPR aka B2169, component of Fructose porter (FruAB) (fructose-1-P forming) from Escherichia coli (see 5 papers)
b2169 fused fructose-specific PTS enzymes: IIA component/HPr component from Escherichia coli str. K-12 substr. MG1655
ECs3061 fructose-specific PTS system IIA component from Escherichia coli O157:H7 str. Sakai
36% identity, 20% coverage
- function: The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The enzyme II FruAB PTS system is involved in fructose transport.
- substrates: fructose
- CyuR is a dual regulator for L-cysteine dependent antimicrobial resistance in Escherichia coli
Rodionova, Communications biology 2024 - “...- 2.8 13 yebK b1853 DNA-binding transcriptional repressor 127 4.61 aAAaAAATaaCAACttTTTtaTC - - 14 fruB b2169 Fructose-specific PTS 192 4.58 GGAaAAATgGCAAaAAaTTgTgC 1.1 - 15 setB b2170 Sugar export transporter 198 4.58 GcAcAAtTTtTTGCcATTTtTCC 1.4 1.4 16 yfaL b2233 Putative autotransporter adhesin 277 4.79 GGcgAAATgGTTGtttTcTATTC - 2.4 17...”
- Global transcriptomic analysis of an engineered Escherichia coli strain lacking the phosphoenolpyruvate: carbohydrate phosphotransferase system during shikimic acid production in rich culture medium
Cortés-Tolalpa, Microbial cell factories 2014 - “...Transport 19.9369 fecB b4290 Ferric dicitrate ABC transporter - periplasmic binding protein Transport 14.5864 fruB b2169 Fructose PTS permease - FruB subunit Transport 5.8528 glpT b2240 GlpT glycerol-3-P MFS transporter Transport 8.6190 lamB b4036 Phage lambda receptor protein; maltose high-affinity receptor Transport 18.0411 livK b3458 Leucine...”
- Antitoxin DinJ influences the general stress response through transcript stabilizer CspE
Hu, Environmental microbiology 2012 - “...2.6 DNA repair Endonuclease yeeS b2002 2.6 CP4-44 prophage; predicted DNA repair protein Transport fruB b2169 9.8 Fructosephosphotransferase enzyme III yddL b1472 4.0 Transport, OmpCFN porin family, N-terminal fragment Metabolism fruK b2168 4.0 Fructose-1-phosphate kinase; 1-phosphofructokinase ybdK b0581 4.3 Glutathione biosynthesis, cysteine ligase activity Cells at...”
- Directed evolution of ionizing radiation resistance in Escherichia coli
Harris, Journal of bacteriology 2009 - “...CB1000 contains a 3-bp in-frame deletion in the fruB (b2169; included in Table S4 in the supplemental material) coding sequence, and CB3000 carries a 93-bp...”
- Escherichia coli gene expression responsive to levels of the response regulator EvgA
Masuda, Journal of bacteriology 2002 - “...basR b4115 yjdE Decreased expression b0553 nmpC b2167 b2168 b2169 fruA fruK fruB b2943 galP Mean Outer membrane porin protein; locus of qsr prophage PTS system,...”
- Recombination-deficient deletions in bacteriophage lambda and their interaction with chi mutations
Henderson, Genetics 1975 - “...is assumed that b2262 leaves REL intact while b1165, b2169 and b1319 delete at least enough of REL to render it inoperative in Int-promoted recombination. We...”
- The Escherichia coli proteome: past, present, and future prospects
Han, Microbiology and molecular biology reviews : MMBR 2006 - “...Theoreticalc Experimentald 4.85/38,938 (DIGE 4.5-6.5) P69811 Multiphosphoryl transfer protein 4.77/39,647.83 FtsA P0ABH0 Cell division protein 5.84/45,329.97...”
- Gene expression induced in Escherichia coli O157:H7 upon exposure to model apple juice
Bergholz, Applied and environmental microbiology 2009 - “...ECs1746 ECs2087 ECs2103 ECs2302 ECs2443 ECs2510 ECs2569 ECs3061 ECs3354 ECs3540 ECs3541 ECs3543 ECs3819 ECs4013 ECs4250 ECs4352 ECs4422 ECs4450 ECs4646 ECs4839...”
- Global transcriptional response of Escherichia coli O157:H7 to growth transitions in glucose minimal medium
Bergholz, BMC microbiology 2007 - “...ECs2463 ynjE putative thiosulfate sulfur transferase 3.47 1 ECs2614 yecH orf, hypothetical protein 3.09 6 ECs3061 fruB PTS system, fructose-specific IIA/fpr component 2.02 1 ECs3084 dsbE disulfide oxidoreductase 2.04 1 ECs3088 ccmC heme exporter protein C 2.19 1 ECs3090 ccmA ATP binding protein of heme exporter...”
- “...yeiT 2.14 3 ECs1037 rmf 2.24 2 ECs3060 fruK -2.13 1 ECs1072 O157 -2.13 5 ECs3061 fruB -2.38 1 ECs1091 O157 3.24 2 ECs3136 yfaX -2.04 1 ECs1137 yccC -2.27 1 ECs3149 menC -2.06 1 ECs1138 yccY -2.78 1 ECs3180 ackA -2.33 6 ECs1139 yccZ -2.74...”
SF5M90T_2187 fused PTS fructose transporter subunit IIA/HPr protein from Shigella flexneri 5a str. M90T
38% identity, 19% coverage
- RNA-seq analysis of the influence of anaerobiosis and FNR on Shigella flexneri
Vergara-Irigaray, BMC genomics 2014 - “...eda keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase 0.97 SF5M90T_580 galK galactokinase 0.95 0.62 SF5M90T_2913 tktA transketolase 1 isozyme 0.80 SF5M90T_2187 fruB PTS system fructose-specific transporter subunit IIA/HPr protein -1.33 SF5M90T_2186 fruK fructose-1-phosphate kinase -1.75 SF5M90T_3161 ptsO phosphocarrier protein NPr -1.76 SF5M90T_1637 putative transport protein -1.93 1.58 SF5M90T_2185 fruA PTS system,...”
ECO26_3081 fused fructose-specific PTS enzymes: IIA component /HPr component from Escherichia coli O26:H11 str. 11368
38% identity, 19% coverage
RSP_1786 Multi-component fructose specific PTS system protein, (PtsI, Hpr, and IIA domains) from Rhodobacter sphaeroides 2.4.1
35% identity, 9% coverage
c2704 PTS system, fructose-specific IIA/FPr component from Escherichia coli CFT073
36% identity, 20% coverage
CS401_RS07595 HPr family phosphocarrier protein from Fusobacterium vincentii
36% identity, 85% coverage
msl5292 phosphocarrier protein HP from Mesorhizobium loti MAFF303099
38% identity, 76% coverage
ACIAD1990 phosphotransferase system, fructose-specific EI/HPr/EIIA components from Acinetobacter sp. ADP1
40% identity, 8% coverage
ETAE_2303 fructose-specific PTS IIA/HPr component from Edwardsiella tarda EIB202
38% identity, 19% coverage
- Coordinate regulation of carbohydrate metabolism and virulence by PtsH in pathogen Edwardsiella piscicida
Mao, Applied microbiology and biotechnology 2022 - “...ptsI Phosphoenolpyruvate-protein phosphotransferase (PEP EI) HPr HPr (PtsH) ETAE_1132 ptsH Phosphohistidinoprotein-hexose phosphotransferase component Fructose FPr ETAE_2303 fruB Fructose-specific PTS HPr component EII Fructose EII BC Fru ETAE_2301 fruA Fructose-specific PTS system IIBC component Glucose EIIA Glc ETAE_1130 crr Glucose-specific PTS system enzyme IIA EIIBC Glc ETAE_2090...”
AH68_00945 HPr family phosphocarrier protein from Bifidobacterium catenulatum PV20-2
29% identity, 99% coverage
TASI_1133 HPr family phosphocarrier protein from Taylorella asinigenitalis MCE3
32% identity, 90% coverage
- Genomic characterization of the Taylorella genus
Hébert, PloS one 2012 - “...We identified genes encoding the PTS Enzyme I (TASI_1132 and TEQUI_0099), the phosphocarrier protein HPr (TASI_1133 and TEQUI_0100), one cytoplasmic protein EIIA (TASI_1134 and TEQUI_0101), one EIIA-like protein PtsN (TASI_0239 and TEQUI_0851) and one HPr kinase/phosphorylase (HprK/P) (TASI_0238 and TEQUI_0850). In the context of bacteria unable...”
PTFAH_VIBCH / Q9KM70 Multiphosphoryl transfer protein; MTP from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) (see 2 papers)
VCA0518 PTS system, fructose-specific IIA/FPR component from Vibrio cholerae O1 biovar eltor str. N16961
40% identity, 18% coverage
- function: The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The enzyme II FruAB PTS system is involved in fructose transport.
disruption phenotype: Does not affect growth on glucose. Mutant shows a slight growth retardation on fructose. - Cra and cAMP Receptor Protein Have Opposing Roles in the Regulation of fruB in Vibrio cholerae
Beck, Journal of bacteriology 2021 - “...capable of both fructose and mannose transport ( 7 , 11 ). VCA0516, VCA0517, and VCA0518 make up the second locus encoding PTS Fru proteins ( 12 ). VCA0518 ( fruB ) encodes the fructose-specific EIIA domain and FPr, which exist as fusion proteins. VCA0517 (...”
- “...in minimal media. FIG 2 Map of the fruBKA locus and fruB promoter transcriptional fusions. VCA0518, VCA0517, and VCA0516 ( fruB , fruK , and fruA, respectively) encode components of the fructose-specific PTS in V. cholerae . VCA0519 ( cra ) encodes a putative transcriptional repressor....”
- Vibrio cholerae FruR facilitates binding of RNA polymerase to the fru promoter in the presence of fructose 1-phosphate
Yoon, Nucleic acids research 2021 - “...fructose PTS (PTS Fru ) consists of the membrane-spanning transporter FruA (VCA0516) and cytosolic FruB (VCA0518). It phosphorylates fructose to fructose 1-phosphate (F1P) during its translocation across the membrane. F1P is then converted to fructose 1,6-bisphosphate (FBP) by the 1-phosphofructokinase FruK (VCA0517). In V. cholerae ,...”
- Transcriptomics reveals a cross-modulatory effect between riboflavin and iron and outlines responses to riboflavin biosynthesis and uptake in Vibrio cholerae
Sepúlveda-Cisternas, Scientific reports 2018 - “...reductase 1.175 VCA0516 ptsIIB PTS system fructose-specific IIBC component 2.838 VCA0517 fruK 1-phosphofructokinase 1.948 1.919 VCA0518 ptsIIA PTS system fructose-specific IIA/FPR component 1.778 1.113 VCA0523 cqsA aminotransferase class II 2.585 VCA0540 formate transporter 1 putative 2.633 4.612 VCA0550 hypothetical protein 1.096 VCA0551 hypothetical protein 1.394 VCA0592...”
- “...ribD or ribN . However, three genes were differentially affected by the mutations. VCA0517 and VCA0518, encoded in an operon of a phosphotransferase system for fructose transport, were upregulated roughly 3.5 times in the ribD strain but downregulated 3.7 and 2.1 times respectively in the ribN...”
- A Genome-Wide Screen Reveals that the Vibrio cholerae Phosphoenolpyruvate Phosphotransferase System Modulates Virulence Gene Expression
Wang, Infection and immunity 2015 - “...C6706 cpdA ptsH C6706 ptsP (VC0672) C6706 fpr (VCA0518) C6706 VC1820 C6706 VCA0245 C6706 VC1822 C6706 VC2013 C6706 VC0995 C6706 VCA1045 C6706 VC0910 PtsI(H189A)...”
- “...pCVD442 carrying an unmarked, in-frame deletion in VCA0518 pCVD442 carrying an unmarked, in-frame deletion in VCA1820 pCVD442 carrying an unmarked, in-frame...”
- Vibrio cholerae phosphoenolpyruvate phosphotransferase system control of carbohydrate transport, biofilm formation, and colonization of the germfree mouse intestine
Houot, Infection and immunity 2010 - “...VC2533 pWM91 carrying an unmarked, in-frame deletion in VCA0518 pWM91 carrying an unmarked, in-frame deletion in VC2531 pWM91 carrying an unmarked, in-frame...”
- “...at 12 12 This study the coding sequence of VCA0518 a VCA0518 variant encoding an H-to-A mutation at This study This study a fragment of VCA0518 encoding...”
- Mining regulatory 5'UTRs from cDNA deep sequencing datasets
Livny, Nucleic acids research 2010 - “...Cold-shock domain-contain protein RLE0357(6) 29 VCA0819 Co-chaperonin GroES RLE0003(75) 30 VCA1075 Hypothetical protein RLE0037 31 VCA0518 Bifunctional fructose-specific PTS protein RLE0062(8) 32 VC2431 DNA topoisomerase IV subunit B RLE0226, SAM 33 VC2738 Phosphoenolpyruvate carboxykinase RLE0239(5) 34* VC1923 Trigger factor RLE0241(7) 35* VC1046 3-ketoacyl-CoA thiolase RLE0244(2) 36...”
- Proteins involved in difference of sorbitol fermentation rates of the toxigenic and nontoxigenic Vibrio cholerae El Tor strains revealed by comparative proteome analysis
Wang, BMC microbiology 2009 - “...more than five peptides matched and sequence coverage greater than 15%. Sequencing of the gene VCA0518 The gene VCA0518 (designated in the genome of N16961, GenBank Accession Number NC002506 ), which corresponds to the fructose-specific IIA/FPR component (PTS system, FIIA), was amplified from all tested strains...”
- “...B, mannitol-1-P dehydrogenase; C, pyruvate dehydrogenase; D, pyruvate formate-lyase 1 activating enzyme. Sequencing of the VCA0518 gene Due to the observed differences on the 2-DE gels (the VCA0518 gene product, FIIA component), the VCA0518 gene from all toxigenic and nontoxigenic strains studied were amplified and sequenced...”
t3176 phosphoryl transfer protein of PTS system from Salmonella enterica subsp. enterica serovar Typhi Ty2
39% identity, 30% coverage
VFMJ11_A1060 bifunctional fructose-specific PTS IIA/HPr protein from Vibrio fischeri MJ11
VFMJ11_A1060 fused PTS fructose transporter subunit IIA/HPr protein from Aliivibrio fischeri MJ11
43% identity, 16% coverage
STM3256 putative phosphotransferase system mannitol/fructose-specific IIA domain from Salmonella typhimurium LT2
39% identity, 30% coverage
- Comparative genomics of Salmonella enterica serovar Montevideo reveals lineage-specific gene differences that may influence ecological niche association
Nguyen, Microbial genomics 2018 - “...[ 46 ]. In addition, a tagatose utilization island tag , which spans STM3251 to STM3256 in Typhimurium [ 47 ], was found but restricted to members of clades I and II ( Fig. 2 ). Clades I and II are also distinguished by the presence...”
- Genetic Characterization of the Galactitol Utilization Pathway of Salmonella enterica Serovar Typhimurium
Nolle, Journal of bacteriology 2017 - “...function in tagatose uptake and metabolization (STM3254 to STM3256) that are absent from the second cluster. The second gat gene cluster, which is flanked...”
- “...of S. enterica serotype 4,[5],12:i: strain CVM23701 lacks STM3256, gatZ, gatA, gatB, and gatC. Thus, the reduced gat gene cluster in both strains sufficiently...”
- Short-term signatures of evolutionary change in the Salmonella enterica serovar typhimurium 14028 genome
Jarvik, Journal of bacteriology 2010 - “...a 5.1-kb deletion that removed at least four genes (STM3256 to STM3259) from the 14028s genome. Aside from genes encoded within prophages, there are no other...”
- Salmonella serovar identification using PCR-based detection of gene presence and absence
Arrach, Journal of clinical microbiology 2008 - “...STM3028, STM3036, STM3082, STM3120, STM3253, STM3254, STM3256, STM3257, STM3260, STM3355, STM3356, STM3357, STM3518, STM3529, STM3548, STM3549, STM3599,...”
- Genomic comparisons of Salmonella enterica serovar Dublin, Agona, and Typhimurium strains recently isolated from milk filters and bovine samples from Ireland, using a Salmonella microarray
Reen, Applied and environmental microbiology 2005 - “...SARB strain Du2. Similarly, region XXI (STM3251 to STM3256), a gene cluster involved in sugar metabolism, was 1619 GENOMIC COMPARISONS OF SALMONELLA STRAINS...”
LA_2402 phosphocarrier protein Hpr from Leptospira interrogans serovar lai str. 56601
40% identity, 75% coverage
- The sigma factor σ54 is required for the long-term survival of Leptospira biflexa in water
Zhang, Molecular microbiology 2018 - “...- Hypothetical protein No hit No hit LEPBI_I1652 2.21 COG1925G Phosphocarrier protein HPr (histidine-containing protein) LA_2402 LBL_1668 LEPBI_I1653 2.20 COG5000T Histidine kinase sensor protein; putative membrane protein LA_2401 LBL_1667 LEPBI_II0220 2.17 - Hypothetical protein LA_2746, LA_4046 LBL_1948, LBL_2853 LEPBI_II0102 2.14 - Hypothetical protein No hit No...”
Csac_1163 Phosphotransferase system, phosphocarrier protein HPr from Caldicellulosiruptor saccharolyticus DSM 8903
36% identity, 79% coverage
blr3574 ptsH from Bradyrhizobium japonicum USDA 110
35% identity, 81% coverage
- Growth Rate of and Gene Expression in Bradyrhizobium diazoefficiens USDA110 due to a Mutation in blr7984, a TetR Family Transcriptional Regulator Gene
Ohkama-Ohtsu, Microbes and environments 2016 - “...transport systems, which uptake substances in cells using energy from ATP hydrolysis. Three genes, blr3573, blr3574, and blr3575, induced in the cluster encode proteins for the phosphotransferase (PTS) sugar system, in which they are phosphorylated and dephosphorylated in a cascading manner until the actual transporter phosphorylates...”
- “...phosphotransferase 12.6 B blr3570 ABC transporter ATP-binding protein 9.7 B blr3572 hypothetical protein 9.0 B blr3574 phosphocarrier protein HPr 7.6 B blr2763 cbb3-type cytochrome c oxidase subunit I, fixN 7.1 A bll5496 metabolite transport protein 6.1 blr3576 hypothetical protein 5.9 B blr2764 cbb3-type cytochrome c oxidase...”
P47287 Phosphocarrier protein HPr from Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
35% identity, 84% coverage
- Subtractive Genomics Approach for Identification of Novel Therapeutic Drug Targets in Mycoplasma genitalium
Fatoba, Pathogens (Basel, Switzerland) 2021 - “...component system P47259 Bifunctional protein FolD K01491 mge01120-Microbial-metabolism-in-diverse-environments P47269 Fructose-bisphosphate aldolase K01624 mge00680-Methane-metabolism, mge01110-Biosynthesis-of-secondary-metabolites, mge01120-Microbial-metabolism-in-diverse-environments P47287 Phosphocarrier protein K02784 mge02060-Phosphotransferase-system-(PTS) P47299 Phosphomannomutase K01840 mge00541-O-Antigen-nucleotide-sugar-biosynthesis, mge01110-Biosynthesis-of-secondary-metabolites P47301 Uncharacterised protein K03073 mge02024-Quorum-sensing, mge03070-Bacterial-secretion-system P47315 PTS system K20118 mge02060-Phosphotransferase-system-(PTS) P47318 Protein translocase subunit K03070 mge02024-Quorum-sensing, mge03070-Bacterial-secretion-system P47323 Oligopeptide transport...”
- “...Nicotinamide adenine dinucleotide phosphate DB03461 Experimental LY249543 DB04322 Experimental P47269 Phosphoglycolohydroxamic acid DB03026 Experimental Cytoplasmic P47287 Dexfosfoserine DB04522 Experimental Cytoplasmic P47357 N-Bromoacetyl-aminoethyl Phosphate DB02257 Experimental Cytoplasmic 5-Phosphoarabinonic acid DB03042 Experimental P47514 NADH DB00157 Approved Cytoplasmic Radicicol DB03758 Experimental Dihydrolipoic acid DB03760 Experimental P47515 Pyruvic acid DB00119...”
SACE_6246 phosphoenolpyruvate-protein phosphotransferase from Saccharopolyspora erythraea NRRL 2338
30% identity, 34% coverage
DR_B0075 PTS system, multiphosphoryl transfer protein, domains EI, HPr, and fructose from Deinococcus radiodurans R1
41% identity, 10% coverage
PFLU5027 putative multiphosphoryl transfer protein from Pseudomonas fluorescens SBW25
45% identity, 8% coverage
Sde_3182 HNH nuclease from Saccharophagus degradans 2-40
36% identity, 91% coverage
OFBG_01695 HPr family phosphocarrier protein from Oxalobacter formigenes OXCC13
30% identity, 91% coverage
- Proteome Dynamics of the Specialist Oxalate Degrader Oxalobacter formigenes
Ellis, Journal of proteomics & bioinformatics 2016 - “...and metabolism and increased in stationary versus log phase included a histidine-containing phosphocarrier transport protein (OFBG_01695), which transfers metabolic carbohydrates across the cell membrane, and various enzymes associated with glycolysis. A glycogen operon is present in the genome of O. formigenes (OFBG_01419 to 01424), and cells...”
SCO5841 phosphocarrier protein hpr from Streptomyces coelicolor A3(2)
O50515 Phosphocarrier protein HPr from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
31% identity, 89% coverage
- Genome-wide analysis of in vivo binding of the master regulator DasR in Streptomyces coelicolor identifies novel non-canonical targets
Świątek-Połatyńska, PloS one 2015 - “...chiB + + + + + + + - - - 7 attggtctggaccaaa -63 10.69 SCO5841 ptsH + + - - - - - - - - 2 + [ 27 ] agttgtctagaccagt -51 18.11 ptsH + + - - - - - - - -...”
- Functional analysis of the N-acetylglucosamine metabolic genes of Streptomyces coelicolor and role in control of development and antibiotic production
Świątek, Journal of bacteriology 2012 - “...SCO5236 SCO2907 SCO2905 SCO4285 SCO2949 SCO5998 SCO4643 SCO4307 SCO5841 SCO1391 nagA nagB nagE2 nagF nagK murA murA2 murB murQ ptsH ptsI Predicted function (EC...”
- Bioinformatic identification of novel regulatory DNA sequence motifs in Streptomyces coelicolor
Studholme, BMC microbiology 2004 - “...encoding chitinases (SCO2503, SCO6012, SCO7225 and SCO7263), phosphoenolpyruvate phosphotransfer transport system (PTS) components (SCO2907 and SCO5841), a hydrolase (SCO6032), amongst others (Table 2, additional file 1 [table2.pdf]). The distance between repeated instances of the motif appeared to be quite variable. The identity of the transcription factor(s)...”
- “...several S. coelicolor genes that encode PTS EII components (SCO1390, SCO2906 and SCO2907) and ptsH (SCO5841) that encodes HPr. The co-occurrence of similar DNA elements upstream of genes encoding glucose-repressible chitinases and upstream of PTS genes, suggests that a regulatory mechanism may be common to both...”
- Residual Helicity at the Active Site of the Histidine Phosphocarrier, HPr, Modulates Binding Affinity to Its Natural Partners
Neira, International journal of molecular sciences 2021 - “...have carried out an extensive description of the structures and conformational stabilities of HPr sc (O50515) and EI (EI sc ) (Q9KZP1) to understand their binding in the PTS cascade [ 11 , 12 , 26 , 27 ]. We have also characterized the interaction of...”
AZOBR_RS32325 Fructose PTS system (E-I, HPr, and E-IIA components) from Azospirillum brasilense Sp245
41% identity, 9% coverage
- mutant phenotype: Specifically important for utilizing D-Fructose. This gene includes components E-I (PEP-protein phoshpotransferase), HPr, and E-IIA. Components E-IIB and E-IIC are in the adjacent gene AZOBR_RS32335.
STY4004 putative PTS system phosphocarrier protein from Salmonella enterica subsp. enterica serovar Typhi str. CT18
STM3779 putative phosphotransferase system, HPr-related protein from Salmonella typhimurium LT2
t3739 putative phosphocarrier protein of PTS system from Salmonella enterica subsp. enterica serovar Typhi Ty2
30% identity, 87% coverage
- CcpA-dependent carbon catabolite repression in bacteria
Warner, Microbiology and molecular biology reviews : MMBR 2003 - “...PTSO PTSO PTSO PTSO PTSO PTSO VC2533 Z4879 STY4004 PTSH PTSH XF1403 GMETP32 DDES2010 131536 16123174 21039016 16273600 23466976 15602763 15616690 21622959...”
- “...HPr and NPr, a third HPrlike molecule, Z4879 and STY4004, respectively. In E. coli, the protein is present only in the enterohemorrhagic strains OD157:H7 and...”
- Genome archaeology of two laboratory Salmonella enterica enterica sv Typhimurium
Zaworski, G3 (Bethesda, Md.) 2021 - “...Present but divergent are locus_ID JJB81_13790 to JJB81_13790 when aligned with LT2 locus_ID STM2679 and STM3779. We infer that this divergent region represents genomic replacement of 106kb of S. sv Typhimurium LT2 by 41kb of S. sv Abony 803 during the second transduction ( Figure 1A...”
- Genomic comparisons of Salmonella enterica serovar Dublin, Agona, and Typhimurium strains recently isolated from milk filters and bovine samples from Ireland, using a Salmonella microarray
Reen, Applied and environmental microbiology 2005 - “...all Dublin strains. A sugar transport cluster spanning genes STM3779 to STM3784 (region XXIII) (Fig. 1) was absent from all serovar Dublin strains except SARB...”
- Staphylococcus aureus Isolated from Ruminants with Mastitis in Northern Greece Dairy Herds: Genetic Relatedness and Phenotypic and Genotypic Characterization
Kotzamanidis, Toxins 2021 - “...48 (30.0) t359 1 (2.9) 0 (0) 0 (0) 0 (0) 0 (0) 1 (0.6) t3739 1 (2.9) 0 (0) 0 (0) 0 (0) 0 (0) 1 (0.6) t4038 2 (5.9) 14 (22.2) 1 (25.0) 5 (20.0) 6 (16.7) 28 (17.3) t524 3 (8.8) 0 (0)...”
TC 4.A.2.1.19 / M7QAG8 PTS system tagatose-specific IIA-TPr component, component of The tagatose-specific PTS transporter/kinase, TagIIA-TPr/TagIIB'BC (tagatose-1-P forming) from Klebsiella pneumoniae ATCC BAA-2146
39% identity, 27% coverage
- substrates: Tagatose
tcdb comment: TagIIA-TPr is a fusion of a IIA domain fused N-terminal to an HPr domain. TagIIB'BC has and inactive IIB' domain fused N-terminal to the active C-terminal IIBC domains. This arrangement resembles that for the E. coli fructose Enzyme II complex
Fisuc_1002 Phosphotransferase system, phosphocarrier protein HPr from Fibrobacter succinogenes subsp. succinogenes S85
30% identity, 92% coverage
- Generation and Characterization of Acid Tolerant Fibrobacter succinogenes S85
Wu, Scientific reports 2017 - “...type II and III secretion system protein (component PulD) Fisuc_0582 2.1 2.47E-10 Sporulation protein YtfJ Fisuc_1002 2.8 7.52E-16 Phosphotransferase system, phosphocarrier protein HPr Fisuc_1095 1.8 0.02141 Pyridoxal-5-phosphate-dependent protein beta subunit (Cysteine synthase) Fisuc_1133 1.4 8.92E-08 YidE/YbjL duplication Fisuc_1215 1.6 0.0242 small multidrug resistance protein (Membrane transporters...”
Q7NZE2 phosphoenolpyruvate--protein phosphotransferase from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
41% identity, 7% coverage
AO356_17540 N-acetylglucosamine-specific PTS system, I, HPr, and IIA components (nagF) from Pseudomonas fluorescens FW300-N2C3
35% identity, 9% coverage
- mutant phenotype: Specific phenotype on NAG as a carbon source. Not sure why SEED think s this includes the IIA component.
VC2533 phosphocarrier protein NPr from Vibrio cholerae O1 biovar eltor str. N16961
38% identity, 85% coverage
- A Genome-Wide Screen Reveals that the Vibrio cholerae Phosphoenolpyruvate Phosphotransferase System Modulates Virulence Gene Expression
Wang, Infection and immunity 2015 - “...protein (42), and a putative nitrogen Hpr protein (VC2533). Finally, V. cholerae encodes at least 20 EII family proteins. The specific sugars transported by...”
- Vibrio cholerae phosphoenolpyruvate phosphotransferase system control of carbohydrate transport, biofilm formation, and colonization of the germfree mouse intestine
Houot, Infection and immunity 2010 - “...VC0966 pWM91 carrying an unmarked, in-frame deletion in VC2533 pWM91 carrying an unmarked, in-frame deletion in VCA0518 pWM91 carrying an unmarked, in-frame...”
- “...VC0672 EI EINtr X X X X X X HPr VC0966 VCA0518 VC2533 HPr FPr NPr X X X X X X X EIIA VC0964 VC1283 VC1820 VC1822 VC1824 VC1826 VC2531 VCA0245 VCA0518 VCA1045...”
- CcpA-dependent carbon catabolite repression in bacteria
Warner, Microbiology and molecular biology reviews : MMBR 2003 - “...VC0966 PTSH PTSO PTSO PTSO PTSO PTSO PTSO VC2533 Z4879 STY4004 PTSH PTSH XF1403 GMETP32 DDES2010 131536 16123174 21039016 16273600 23466976 15602763 15616690...”
LBL_1668 Phosphocarrier protein HPr-related from Leptospira borgpetersenii serovar Hardjo-bovis L550
39% identity, 75% coverage
- The sigma factor σ54 is required for the long-term survival of Leptospira biflexa in water
Zhang, Molecular microbiology 2018 - “...Hypothetical protein No hit No hit LEPBI_I1652 2.21 COG1925G Phosphocarrier protein HPr (histidine-containing protein) LA_2402 LBL_1668 LEPBI_I1653 2.20 COG5000T Histidine kinase sensor protein; putative membrane protein LA_2401 LBL_1667 LEPBI_II0220 2.17 - Hypothetical protein LA_2746, LA_4046 LBL_1948, LBL_2853 LEPBI_II0102 2.14 - Hypothetical protein No hit No hit...”
SMc02754 PUTATIVE PHOSPHOCARRIER HPR TRANSMEMBRANE PROTEIN from Sinorhizobium meliloti 1021
30% identity, 83% coverage
- Biochemical characterization of a nitrogen-type phosphotransferase system reveals that enzyme EI(Ntr) integrates carbon and nitrogen signaling in Sinorhizobium meliloti
Goodwin, Journal of bacteriology 2014 - “...The genes for HPr and EINtr, hpr (smc02754) and ptsP (smc02437), respectively, were amplified using high-fidelity Phusion polymerase (New England BioLabs)...”
- Regulatory and DNA repair genes contribute to the desiccation resistance of Sinorhizobium meliloti Rm1021
Humann, Applied and environmental microbiology 2009 - “...of desiccation mutants Strain Gene NAe NA SMc02659 SMc01506 SMc02754 SMc00602 NA NA relA rpoE2 hpr uvrC Results for indicated assayb No. of aa encoded by ORF...”
- “...the storage phase. The homolog of S. meliloti hpr (SMc02754) in B. japonicum, ptsH (blr8148), is upregulated during desiccation (6), indicating that hpr may be...”
- HPrK regulates succinate-mediated catabolite repression in the gram-negative symbiont Sinorhizobium meliloti
Pinedo, Journal of bacteriology 2009 - “...proteins. Genes for an EI-type protein (SMc02437), HPr (SMc02754), EIIA-type proteins ManX (SMc02753) and EIIANtr (SMc01141), and HPrK (SMc02752) are present in...”
- Sinorhizobium meliloti mutants lacking phosphotransferase system enzyme HPr or EIIA are altered in diverse processes, including carbon metabolism, cobalt requirements, and succinoglycan production
Pinedo, Journal of bacteriology 2008 - “...assemble a complete PTS. The genome of S. meliloti contains smc02754 (hpr), a gene similar to ptsH (coding for HPr in E. coli) and smc02753 (manX) (coding a...”
- “...of an unmarked, in-frame deletion of the hpr gene (smc02754), the 5 end of hpr and the upstream sequence were amplified from strain Rm1021 genomic DNA using...”
- CcpA-dependent carbon catabolite repression in bacteria
Warner, Microbiology and molecular biology reviews : MMBR 2003 - “...degradans Azotobacter vinelandii Escherichia coli MSL5292 MSL5090 SMC02754 AGRC49 BMEI2031 RPALP163 CC0241 RSPHP157 MAGNP479 SAROP34 RRUBP475 MAGNP76 PTHP PSTH...”
ORF00572 multiphosphoryl transfer protein, putative from Desulfovibrio vulgaris Hildenborough
35% identity, 9% coverage
PTHP_HALVD / D4GYE3 Phosphocarrier protein HPr from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) (Halobacterium volcanii) (see paper)
HVO_1497 phosphocarrier protein Hpr from Haloferax volcanii DS2
29% identity, 91% coverage
- function: General (non sugar-specific) component of the phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS). This major carbohydrate active-transport system catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The phosphoryl group from phosphoenolpyruvate (PEP) is transferred to the phosphoryl carrier protein HPr by enzyme I. Phospho-HPr then transfers it to the PTS EIIA domain (By similarity). Is involved in fructose transport.
- Fructose degradation in the haloarchaeon Haloferax volcanii involves a bacterial type phosphoenolpyruvate-dependent phosphotransferase system, fructose-1-phosphate kinase, and class II fructose-1,6-bisphosphate aldolase
Pickl, Journal of bacteriology 2012 - “...EIIA, and EIIB (encoded by HVO_1496 [ptsI], HVO_1497 [ptsH1], HVO_1498 [ptfA], and HVO_1495 [ptfB], respectively) and the transmembrane component EIIC (encoded...”
- “...[ptfC]) in red, EIIA (HVO_1498[ptfA]) in blue, HPr (HVO_1497 [ptsH1]) in orange, EI (HVO_1496 [ptsI]) in purple, EIIB (HVO_1495 [ptfB]) in dark blue, and...”
SPV1_10234 hypothetical protein from Mariprofundus ferrooxydans PV-1
28% identity, 93% coverage
- Mariprofundus ferrooxydans PV-1 the first genome of a marine Fe(II) oxidizing Zetaproteobacterium
Singer, PloS one 2011 - “...however PV-1 possesses a predicted operon (SPV1_t10271, SPV1_10194, SPV1_10199, SPV1_10204, SPV1_10209, SPV1_10214, SPV1_10219, SPV1_10224, SPV1_10229, SPV1_10234, SPV1_, SPV1_10239) encoding for a phosphoenolypyruvate-dependent sugar phosphotransferase system (PTS), which is the major carbohydrate transport system in bacteria [37] . The PTS enzyme II is a fructose/mannose-specific transporter in...”
HMPREF0010_00382 phosphoenolpyruvate--protein phosphotransferase from Acinetobacter baumannii ATCC 19606 = CIP 70.34 = JCM 6841
39% identity, 8% coverage
- Delineating the Plausible Molecular Vaccine Candidates and Drug Targets of Multidrug-Resistant Acinetobacter baumannii
Mujawar, Frontiers in cellular and infection microbiology 2019 - “...EC measures, while HMPREF0010_01789 from EC and three candidates from BC, namely, HMPREF0010_03553, HMPREF0010_01114, and HMPREF0010_00382, were unique. It is important to note that sorting of the whole genome proteins as per the four centrality measures yielded 2, 0, 14, and 15, respectively, of which 0,...”
- Constraint-based modeling identifies new putative targets to fight colistin-resistant A. baumannii infections
Presta, Scientific reports 2017 - “...yes no yes no no no HMPREF0010_03273 glucose-6-phosphate isomerase yes no yes no no no HMPREF0010_00382 phosphotransferase system fructose-specific EI/HPr/EIIA component yes no yes no no no HMPREF0010_03275 UTP-glucose-1-phosphate uridylyltransferase yes no yes no no no HMPREF0010_01305 alphaalpha-trehalose-phosphate synthase (UDP-forming) yes no yes no no no...”
A1S_1945 phosphotransferase system fructose-specific EI/HPr/EIIA components from Acinetobacter baumannii ATCC 17978
39% identity, 9% coverage
- Uncovering the mechanisms of Acinetobacter baumannii virulence
Harding, Nature reviews. Microbiology 2018 - “...the absence of lipid A, A. baumannii has been shown to upregulate lipoproteins, namely A1S_1944, A1S_1945 and A1S_2739, which stabilize the outer membrane 84 . The accumulation of the capsular polysaccharide poly-1,6- N -Acetylglucosamine (PNAG) has also been observed in strains lacking lipid A as a...”
DHAM_PANAM / D4GL26 PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM; Dihydroxyacetone kinase subunit M; EC 2.7.1.121 from Pantoea ananatis (strain LMG 20103) (see 2 papers)
33% identity, 16% coverage
- function: Component of the dihydroxyacetone kinase complex, which is responsible for the phosphoenolpyruvate (PEP)-dependent phosphorylation of dihydroxyacetone. DhaM serves as the phosphoryl donor. Is phosphorylated by phosphoenolpyruvate in an EI- and HPr-dependent reaction, and a phosphorelay system on histidine residues finally leads to phosphoryl transfer to DhaL and dihydroxyacetone.
catalytic activity: dihydroxyacetone + phosphoenolpyruvate = dihydroxyacetone phosphate + pyruvate (RHEA:18381)
subunit: Homodimer. The dihydroxyacetone kinase complex is composed of a homodimer of DhaM, a homodimer of DhaK and the subunit DhaL.
PA14_57980 putative phosphoryl carrier protein from Pseudomonas aeruginosa UCBPP-PA14
Q9HVV2 Phosphocarrier protein HPr from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
PA4466 probable phosphoryl carrier protein from Pseudomonas aeruginosa PAO1
36% identity, 86% coverage
- Promoter selectivity of the RhlR quorum-sensing transcription factor receptor in Pseudomonas aeruginosa is coordinated by distinct and overlapping dependencies on C4-homoserine lactone and PqsE
Keegan, PLoS genetics 2023 - “...3189.2 0.9, 6.8 1.0, 0.9 0.8, 2.1 Mukherjee, Letizia, Asfahl, Cruz 5159548 PA14_57970 * , PA14_57980 CAACTGTTACATATGAGCGGT 881.2 12.7 106.4 236.3 0.9, 1.0 1.2, 1.5 0.9, 1.1 - 5268881 PA14_59180 * CAACTCGCAGAACTGGTGGGG 679.5 29.4 185.2 247.1 0.9 0.5 0.7 - 6082366 rmlB operon CACCTACCAGATCTGGGGTTG 10477.0 23.2...”
- The sensor kinase KinB regulates virulence in acute Pseudomonas aeruginosa infection
Chand, Journal of bacteriology 2011 - “...(29763), PA14_36420 (39759), PA14_59800 (24601), PA14_57980 (32292), PA14_38970 (1242), PA14_16470 (25859), PA14_02250 (28227), PA14_45590 (34047), PA14_05390...”
- Protein interactions in human pathogens revealed through deep learning
Humphreys, Nature microbiology 2024 - “...delivers ammonia to WbpG 38 , a hypothesis our interaction finding supports. The PtsHPtsN ( Q9HVV2 - Q9HVV4 ) pair with the highest support by STRING (score=959) failed to generate a positive Co-IP signal (Supplementary Fig. 13 ); PtsH is a histidine-phosphorylatable phosphocarrier protein encoded adjacent...”
- Distinct transcriptome and traits of freshly dispersed <i>Pseudomonas aeruginosa</i> cells
Kalia, mSphere 2024 - “...hypothetical protein Downregulated 0.44342 Downregulated 0.86057 PA4408 Cell division protein FtsA Downregulated 0.51826 Downregulated 0.96422 PA4466 Probable phosphoryl carrier protein Downregulated 0.10875 Downregulated 0.17412 PA4876 smE Downregulated 0.26483 Downregulated 0.46575 a Transcript abundance of genes that are uniquely expressed in glutamate and nitric oxide dispersed cells,...”
- Network analysis for identifying potential anti-virulence targets from whole transcriptome of Pseudomonas aeruginosa and Staphylococcus aureus exposed to certain anti-pathogenic polyherbal formulations
Ruparel, Drug target insights 2023 - “...2.73 4.90E-06 34 PA1879 Hypothetical protein 2.71 1.94E-05 35 PA0270 Hypothetical protein 2.70 0.002 36 PA4466 Phosphoryl carrier protein 2.68 9.20E-06 37 PA0806 Hypothetical protein 2.68 0.006 38 rluA Ribosomal large subunit pseudouridine synthase A 2.66 0.001 39 PA2506 Hypothetical protein 2.66 0.01 40 lldD L-lactate...”
- Role of lon, an ATP-dependent protease homolog, in resistance of Pseudomonas aeruginosa to ciprofloxacin
Brazas, Antimicrobial agents and chemotherapy 2007 - “...PA3082 PA3294 PA3617 PA3777 PA3965 PA4163 PA4316 PA4316 PA4422 PA4466 PA4700 PA4700 PA4756 PA4763 PA4961 PA5016 PA5208 PA5279 PA5345 a Gene name ilvD lon lon...”
- CcpA-dependent carbon catabolite repression in bacteria
Warner, Microbiology and molecular biology reviews : MMBR 2003 - “...PTHP PSTH REUTP495f NEURP196 BCEPP510 NMB2045 PTHP PA4466 PFLUP387 PTSO MDEGP161 AVINP175 PTSH 13474414 13474245 15963793 15887388 17988314 22962348 16124496...”
ECs4354 phosphotransferase system HPr enzyme from Escherichia coli O157:H7 str. Sakai
31% identity, 93% coverage
Z4879 putative phosphocarrier protein from Escherichia coli O157:H7 EDL933
31% identity, 93% coverage
Ccel_0806 HPr family phosphocarrier protein from Ruminiclostridium cellulolyticum H10
Ccel_0806 phosphocarrier, HPr family from Clostridium cellulolyticum H10
36% identity, 91% coverage
- Functional and structural diversification of incomplete phosphotransferase system in cellulose-degrading clostridia
Xu, The ISME journal 2023 - “...of early stop codons, the knockout mutants of Ccel_0806, Ccel_1005, and Ccel_1438 were generated and named cph, ccpA, and ccpB, respectively. We also performed...”
- Structure and regulation of the cellulose degradome in Clostridium cellulolyticum
Xu, Biotechnology for biofuels 2013 - “...intracellular glycolytic intermediates. Consequently, a homologue of the phosphocarrier proteins (Crh (catabolite repression HPr)-like protein, Ccel_0806) remains dephosphorylated and prevents the CcpA homologues, such as LfpC 2 (Ccel_2999) or LfpC3 (Ccel_3000), from inhibiting the transcription of the major cellulosomal genes (except the xyl-doc gene cluster) or...”
RL2903 putative multiphosphoryl transfer/phosphocarrier protein from Rhizobium leguminosarum bv. viciae 3841
31% identity, 67% coverage
- ABC transport is inactivated by the PTS(Ntr) under potassium limitation in Rhizobium leguminosarum 3841
Untiet, PloS one 2013 - “...been identified. An inspection of the Rlv3841 genome produced two possible candidate genes, RL0032 and RL2903, which are annotated as putative phosphocarrier proteins. RL0032 shows 37% and 33% identity to NPr and HPr from E. coli K12, while RL2903 has 28% and 31% identity, respectively. RL0032...”
- “...final phosphorylation acceptor of this cascade is probably EIIA Man . The second npr candidate, RL2903, is part of a dihydroxy acetone PTS which is likely functional in rhizobia [37] . RL0032 is NPr, the Missing link in the PTS Ntr Phosphorylation Cascade We mutated RL0032...”
ptsH / AAA86048.1 PTS HPr from Geobacillus stearothermophilus (see paper)
31% identity, 73% coverage
PP0948, PP_0948 phosphotransferase system, NPr protein from Pseudomonas putida KT2440
35% identity, 90% coverage
TC 4.A.2.1.17 / Q9HY55 Phosphotransferase system transporter enzyme I, FruI, component of Fructose-specific PTS permease, FruIIBC/FruI-HPr-IIA from Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)
PA3562 probable phosphotransferase system enzyme I from Pseudomonas aeruginosa PAO1
39% identity, 8% coverage
PA14_18250 putative phosphotransferase system, fructose-specific component from Pseudomonas aeruginosa UCBPP-PA14
39% identity, 8% coverage
Blon_0177 Phosphotransferase system, phosphocarrier protein HPr from Bifidobacterium longum subsp. infantis ATCC 15697
33% identity, 94% coverage
BAW_12011 HPr family phosphocarrier protein from Brucella abortus
BAB1_2097 Phosphocarrier HPr protein:Histidine phosphorylation site in HPr protein from Brucella melitensis biovar Abortus 2308
28% identity, 73% coverage
HWN72_20610 phosphoenolpyruvate--protein phosphotransferase from Novosphingobium sp. HR1a
35% identity, 8% coverage
- LuxR402 of Novosphingobium sp. HR1a regulates the correct configuration of cell envelopes
Segura, Frontiers in microbiology 2023 - “...with the wild-type strain ( Table 2 ). Four of these genes ( HWN72_20595 to HWN72_20610 ) encoded functions related with carbohydrate transport and utilization and with the phosphotransferase transport system (PTS). HWN72_20595 (putative OprB) was also previously identified in our proteomic analysis ( Table 1...”
- “...OprB family HWN72_20600 4.94 PTS fructose transporter subunit EIIB/C HWN72_20605 4.28 1-phosphofructokinase ( pfkB ) HWN72_20610 2.94 Phosphoenolpyruvateprotein phosphotransferase 2 ( ptsP ) HWN72_14810 4.69 Hypothetical protein HWN72_14815 1.82 Polysaccharide biosynthesis tyrosine autokinase HWN72_14090 3.45 homocysteine S-methyltransferase family protein HWN72_14095 3.25 GNAT family N-acetyltransferase Novel00673 2.10...”
BMEI2031 PHOSPHOCARRIER PROTEIN HPR from Brucella melitensis 16M
28% identity, 76% coverage
Rmet_4664 phosphoryl transfer system protein HPr from Ralstonia metallidurans CH34
28% identity, 95% coverage
msl5090 phosphocarrier protein HPr from Mesorhizobium loti MAFF303099
29% identity, 81% coverage
TC 4.A.1.1.15 / Q9HXN5 N-Acetyl-D-Glucosamine phosphotransferase system transporter, component of N-acetyl glucosamine-specific PTS permease, GlcNAc IIBC/GlcNAc I-HPr-IIA from Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)
PA3760 probable phosphotransferase protein from Pseudomonas aeruginosa PAO1
39% identity, 7% coverage
- substrates: N-acetyl glucosamine
- Impact of transient acquired hypermutability on the inter- and intra-species competitiveness of Pseudomonas aeruginosa
On, The ISME journal 2023 - “...indicated. Multiple ORFs contributed to the peaks and troughs, although a small number of loci (PA3760, encoding a Pts system component (NagF); PA1740, encoding a hypothetical protein; and PA4100, encoding a likely dehydrogenase) appeared to be hotspots for selection. Acquisition of hypermutability confers a fitness advantage...”
- PtsN in Pseudomonas aeruginosa Is Phosphorylated by Redundant Upstream Proteins and Impacts Virulence-Related Genes
Underhill, Journal of bacteriology 2023 (secret) - The development of a new parameter for tracking post-transcriptional regulation allows the detailed map of the Pseudomonas aeruginosa Crc regulon
Corona, Scientific reports 2018 - “...Glycerol-3-phosphate dehydrogenase 2,87 0,16 3,31 Transport PA3690 Probable metal-transporting P-type ATPase 0,46 1,02 3,36 Transport PA3760 N-Acetyl-D-Glucosamine phosphotransferase system transporter 0,5 0,44 1,76 Transport PA3779 Hypothetical protein 0 0,89 2,54 Transport PA3838 Probable ATP-binding component of ABC transporter 0,44 0,49 1,84 Iron fecA PA3901 Fe(III) dicitrate...”
- Pseudomonas aeruginosa enhances production of an antimicrobial in response to N-acetylglucosamine and peptidoglycan
Korgaonkar, Journal of bacteriology 2011 - “...upregulationb GlcNAc catabolism PA3757 PA3758 PA3759 PA3760 PA3761 nagR nagA glmS nagF nagE Probable transcriptional regulator N-Acetylglucosamine-6-phosphate...”
- Genome diversity of Pseudomonas aeruginosa PAO1 laboratory strains
Klockgether, Journal of bacteriology 2010 - “...Interg. (PA0369-PA0370) Interg. (PA1352-PA1353) Interg. (PA2046-PA2047) PA3760 PA3877 4448855 4448856 4869855 4924552 4924553 5036891c 5743461 5743462 6098781...”
- “...in our laboratory showed intragenic deletions in PA1695 and PA3760 compared to the published PAO1-UW sequence. Second, the PAO1-DSM subline lacked 2 of the 18...”
- High-throughput phenotypic characterization of Pseudomonas aeruginosa membrane transport genes
Johnson, PLoS genetics 2008 - “...I ( FruI ) PA3597 PAK amino acid APC family transporter PA3641 PAK alanine/sodium symporter PA3760 PAK N-Acetyl-D-Glucosamine acphosphotransferase system transporter PA3761 PAK N-Acetyl-D-Glucosamine phosphotransferase system transporter PA3865 PAK arginine/ornithine ABC transporter periplasmic binding protein PA3889 PAK glycine ABC transporter periplasmic binding protein PA4023 PAK ethanolamine...”
- “...D-Fructose C - PA3562 phosphotransferase system transporter enzyme I ( FruI ) D-Fructose C - PA3760 N-Acetyl-D-Glucosamine phosphotransferase system transporter N-Acetyl-D-Glucosamine N - PA3761 N-Acetyl-D-Glucosamine phosphotransferase system transporter N-Acetyl-D-Glucosamine C+N - PA4910 branched chain amino acid ABC transporter ATP binding protein D-Alanine N +/ PA4912 branched...”
PA14_15790 putative phosphoenolpyruvate-protein phosphotransferase from Pseudomonas aeruginosa UCBPP-PA14
39% identity, 7% coverage
TC 4.A.2.1.26 / Q5V5X3 Phosphocarrier protein Hpr, component of Fructose-specific Enzyme I-HPr-Enzyme IIABC complex, all encoded within a single operon with genes in the order: ptsC (IIC), ptsA (IIA), ptsH (HPr), ptsI (Enzyme I) and ptsB (IIB) from Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
26% identity, 84% coverage
For advice on how to use these tools together, see
Interactive tools for functional annotation of bacterial genomes.
The PaperBLAST database links 793,807 different protein sequences to 1,259,118 scientific articles. Searches against EuropePMC were last performed on March 13 2025.
PaperBLAST builds a database of protein sequences that are linked
to scientific articles. These links come from automated text searches
against the articles in EuropePMC
and from manually-curated information from GeneRIF, UniProtKB/Swiss-Prot,
BRENDA,
CAZy (as made available by dbCAN),
BioLiP,
CharProtDB,
MetaCyc,
EcoCyc,
TCDB,
REBASE,
the Fitness Browser,
and a subset of the European Nucleotide Archive with the /experiment tag.
Given this database and a protein sequence query,
PaperBLAST uses protein-protein BLAST
to find similar sequences with E < 0.001.
To build the database, we query EuropePMC with locus tags, with RefSeq protein
identifiers, and with UniProt
accessions. We obtain the locus tags from RefSeq or from MicrobesOnline. We use
queries of the form "locus_tag AND genus_name" to try to ensure that
the paper is actually discussing that gene. Because EuropePMC indexes
most recent biomedical papers, even if they are not open access, some
of the links may be to papers that you cannot read or that our
computers cannot read. We query each of these identifiers that
appears in the open access part of EuropePMC, as well as every locus
tag that appears in the 500 most-referenced genomes, so that a gene
may appear in the PaperBLAST results even though none of the papers
that mention it are open access. We also incorporate text-mined links
from EuropePMC that link open access articles to UniProt or RefSeq
identifiers. (This yields some additional links because EuropePMC
uses different heuristics for their text mining than we do.)
For every article that mentions a locus tag, a RefSeq protein
identifier, or a UniProt accession, we try to select one or two
snippets of text that refer to the protein. If we cannot get access to
the full text, we try to select a snippet from the abstract, but
unfortunately, unique identifiers such as locus tags are rarely
provided in abstracts.
PaperBLAST also incorporates manually-curated protein functions:
- Proteins from NCBI's RefSeq are included if a
GeneRIF
entry links the gene to an article in
PubMed®.
GeneRIF also provides a short summary of the article's claim about the
protein, which is shown instead of a snippet.
- Proteins from Swiss-Prot (the curated part of UniProt)
are included if the curators
identified experimental evidence for the protein's function (evidence
code ECO:0000269). For these proteins, the fields of the Swiss-Prot entry that
describe the protein's function are shown (with bold headings).
- Proteins from BRENDA,
a curated database of enzymes, are included if they are linked to a paper in PubMed
and their full sequence is known.
- Every protein from the non-redundant subset of
BioLiP,
a database
of ligand-binding sites and catalytic residues in protein structures, is included. Since BioLiP itself
does not include descriptions of the proteins, those are taken from the
Protein Data Bank.
Descriptions from PDB rely on the original submitter of the
structure and cannot be updated by others, so they may be less reliable.
(For SitesBLAST and Sites on a Tree, we use a larger subset of BioLiP so that every
ligand is represented among a group of structures with similar sequences, but for
PaperBLAST, we use the non-redundant set provided by BioLiP.)
- Every protein from EcoCyc, a curated
database of the proteins in Escherichia coli K-12, is included, regardless
of whether they are characterized or not.
- Proteins from the MetaCyc metabolic pathway database
are included if they are linked to a paper in PubMed and their full sequence is known.
- Proteins from the Transport Classification Database (TCDB)
are included if they have known substrate(s), have reference(s),
and are not described as uncharacterized or putative.
(Some of the references are not visible on the PaperBLAST web site.)
- Every protein from CharProtDB,
a database of experimentally characterized protein annotations, is included.
- Proteins from the CAZy database of carbohydrate-active enzymes
are included if they are associated with an Enzyme Classification number.
Even though CAZy does not provide links from individual protein sequences to papers,
these should all be experimentally-characterized proteins.
- Proteins from the REBASE database
of restriction enzymes are included if they have known specificity.
- Every protein with an evidence-based reannotation (based on mutant phenotypes)
in the Fitness Browser is included.
- Sequence-specific transcription factors (including sigma factors and DNA-binding response regulators)
with experimentally-determined DNA binding sites from the
PRODORIC database of gene regulation in prokaryotes.
- Putative transcription factors from RegPrecise
that have manually-curated predictions for their binding sites. These predictions are based on
conserved putative regulatory sites across genomes that contain similar transcription factors,
so PaperBLAST clusters the TFs at 70% identity and retains just one member of each cluster.
- Coding sequence (CDS) features from the
European Nucleotide Archive (ENA)
are included if the /experiment tag is set (implying that there is experimental evidence for the annotation),
the nucleotide entry links to paper(s) in PubMed,
and the nucleotide entry is from the STD data class
(implying that these are targeted annotated sequences, not from shotgun sequencing).
Also, to filter out genes whose transcription or translation was detected, but whose function
was not studied, nucleotide entries or papers with more than 25 such proteins are excluded.
Descriptions from ENA rely on the original submitter of the
sequence and cannot be updated by others, so they may be less reliable.
Except for GeneRIF and ENA,
the curated entries include a short curated
description of the protein's function.
For entries from BioLiP, the protein's function may not be known beyond binding to the ligand.
Many of these entries also link to articles in PubMed.
For more information see the
PaperBLAST paper (mSystems 2017)
or the code.
You can download PaperBLAST's database here.
Changes to PaperBLAST since the paper was written:
- November 2023: incorporated PRODORIC and RegPrecise. Many PRODORIC entries were not linked to a protein sequence (no UniProt identifier), so we added this information.
- February 2023: BioLiP changed their download format. PaperBLAST now includes their non-redundant subset. SitesBLAST and Sites on a Tree use a larger non-redundant subset that ensures that every ligand is represented within each cluster. This should ensure that every binding site is represented.
- June 2022: incorporated some coding sequences from ENA with the /experiment tag.
- March 2022: incorporated BioLiP.
- April 2020: incorporated TCDB.
- April 2019: EuropePMC now returns table entries in their search results. This has expanded PaperBLAST's database, but most of the new entries are of low relevance, and the resulting snippets are often just lists of locus tags with annotations.
- February 2018: the alignment page reports the conservation of the hit's functional sites (if available from from Swiss-Prot or UniProt)
- January 2018: incorporated BRENDA.
- December 2017: incorporated MetaCyc, CharProtDB, CAZy, REBASE, and the reannotations from the Fitness Browser.
- September 2017: EuropePMC no longer returns some table entries in their search results. This has shrunk PaperBLAST's database, but has also reduced the number of low-relevance hits.
Many of these changes are described in Interactive tools for functional annotation of bacterial genomes.
PaperBLAST cannot provide snippets for many of the papers that are
published in non-open-access journals. This limitation applies even if
the paper is marked as "free" on the publisher's web site and is
available in PubmedCentral or EuropePMC. If a journal that you publish
in is marked as "secret," please consider publishing elsewhere.
Many important articles are missing from PaperBLAST, either because
the article's full text is not in EuropePMC (as for many older
articles), or because the paper does not mention a protein identifier such as a locus tag, or because of PaperBLAST's heuristics. If you notice an
article that characterizes a protein's function but is missing from
PaperBLAST, please notify the curators at UniProt
or add an entry to GeneRIF.
Entries in either of these databases will eventually be incorporated
into PaperBLAST. Note that to add an entry to UniProt, you will need
to find the UniProt identifier for the protein. If the protein is not
already in UniProt, you can ask them to create an entry. To add an
entry to GeneRIF, you will need an NCBI Gene identifier, but
unfortunately many prokaryotic proteins in RefSeq do not have
corresponding Gene identifers.
References
PaperBLAST: Text-mining papers for information about homologs.
M. N. Price and A. P. Arkin (2017). mSystems, 10.1128/mSystems.00039-17.
Europe PMC in 2017.
M. Levchenko et al (2017). Nucleic Acids Research, 10.1093/nar/gkx1005.
Gene indexing: characterization and analysis of NLM's GeneRIFs.
J. A. Mitchell et al (2003). AMIA Annu Symp Proc 2003:460-464.
UniProt: the universal protein knowledgebase.
The UniProt Consortium (2016). Nucleic Acids Research, 10.1093/nar/gkw1099.
BRENDA in 2017: new perspectives and new tools in BRENDA.
S. Placzek et al (2017). Nucleic Acids Research, 10.1093/nar/gkw952.
The EcoCyc database: reflecting new knowledge about Escherichia coli K-12.
I. M. Keeseler et al (2016). Nucleic Acids Research, 10.1093/nar/gkw1003.
The MetaCyc database of metabolic pathways and enzymes.
R. Caspi et al (2018). Nucleic Acids Research, 10.1093/nar/gkx935.
CharProtDB: a database of experimentally characterized protein annotations.
R. Madupu et al (2012). Nucleic Acids Research, 10.1093/nar/gkr1133.
The carbohydrate-active enzymes database (CAZy) in 2013.
V. Lombard et al (2014). Nucleic Acids Research, 10.1093/nar/gkt1178.
The Transporter Classification Database (TCDB): recent advances
M. H. Saier, Jr. et al (2016). Nucleic Acids Research, 10.1093/nar/gkv1103.
REBASE - a database for DNA restriction and modification: enzymes, genes and genomes.
R. J. Roberts et al (2015). Nucleic Acids Research, 10.1093/nar/gku1046.
Deep annotation of protein function across diverse bacteria from mutant phenotypes.
M. N. Price et al (2016). bioRxiv, 10.1101/072470.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory