Comparing IAI46_18455 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
1pohA The 2.0 angstroms resolution structure of escherichia coli histidine- containing phosphocarrier protein hpr: a redetermination (see paper)
99% identity, 100% coverage: 1:85/85 of query aligns to 1:85/85 of 1pohA
1j6tB Complex of enzyme iiamtl and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure (see paper)
99% identity, 100% coverage: 1:85/85 of query aligns to 1:85/85 of 1j6tB
P0AA04 Phosphocarrier protein HPr; Histidine-containing protein from Escherichia coli (strain K12) (see paper)
99% identity, 100% coverage: 1:85/85 of query aligns to 1:85/85 of P0AA04
O06976 HPr-like protein Crh; Catabolite repression HPr from Bacillus subtilis (strain 168) (see 3 papers)
47% identity, 98% coverage: 1:83/85 of query aligns to 1:83/85 of O06976
O69250 Phosphocarrier protein HPr; Histidine-containing protein from Priestia megaterium (Bacillus megaterium) (see 2 papers)
42% identity, 98% coverage: 1:83/85 of query aligns to 1:83/88 of O69250
Q84F84 Phosphocarrier protein HPr; Histidine-containing protein from Lysinibacillus sphaericus (Bacillus sphaericus) (see paper)
42% identity, 99% coverage: 1:84/85 of query aligns to 1:84/88 of Q84F84
P24366 Phosphocarrier protein HPr; Histidine-containing protein from Streptococcus salivarius (see paper)
41% identity, 95% coverage: 1:81/85 of query aligns to 1:81/87 of P24366
Q9CJ83 Phosphocarrier protein HPr; Histidine-containing protein from Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) (see paper)
42% identity, 95% coverage: 1:81/85 of query aligns to 1:81/88 of Q9CJ83
P08877 Phosphocarrier protein HPr; Histidine-containing protein from Bacillus subtilis (strain 168) (see 5 papers)
37% identity, 95% coverage: 1:81/85 of query aligns to 1:81/88 of P08877
Q9WXK8 Phosphocarrier protein HPr; Histidine-containing protein from Streptococcus equinus (Streptococcus bovis) (see paper)
45% identity, 79% coverage: 1:67/85 of query aligns to 1:67/87 of Q9WXK8
Q9F166 Phosphocarrier protein HPr from Bacillus thuringiensis subsp. israelensis (see 2 papers)
37% identity, 79% coverage: 8:74/85 of query aligns to 7:73/87 of Q9F166
P75061 Phosphocarrier protein HPr; Histidine-containing protein from Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) (Mycoplasmoides pneumoniae) (see paper)
37% identity, 87% coverage: 1:74/85 of query aligns to 1:75/88 of P75061
O50515 Phosphocarrier protein HPr; Histidine-containing protein from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see paper)
31% identity, 98% coverage: 1:83/85 of query aligns to 1:84/93 of O50515
P37349 PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM; Dihydroxyacetone kinase subunit M; EC 2.7.1.121 from Escherichia coli (strain K12) (see paper)
29% identity, 81% coverage: 6:74/85 of query aligns to 160:228/472 of P37349
Sites not aligning to the query:
>IAI46_18455
MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSDITVTSNGKSASAKSLFKLQTLGLTQGTV
VTISAEGEDEQKAVEHLVKLMAELE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory