PaperBLAST

PaperBLAST Hits for Pf6N2E2_2394 (75 a.a., MTSVFDREDI...)

Show query sequence

>Pf6N2E2_2394
MTSVFDREDIVFQVVVNHEEQYSIWPDYKAVPEGWRTVGKSGFKKECLAYIEEVWTDMRP
LSLRKKMEEQAAAAH

Running BLASTp...

Found 82 similar proteins in the literature:

AL066_04890 MbtH family protein from Pseudomonas nunensis
92% identity, 100% coverage

• Transcriptomic profiling of microbe-microbe interactions reveals the specific response of the biocontrol strain P. fluorescens In5 to the phytopathogen Rhizoctonia solani
  Hennessy, BMC research notes 2017
  • “...2 ; Additional file 4 : Table S2), an upregulated gene encoding an Mbth-like protein (AL066_04890) and a downregulated gene encoding a putative AlpA transcriptional regulator (AL066_26360). Interestingly, no transcripts were upregulated more than twofold in R. solani and downregulated more than twofold in P. aphanidermatum...”
  • “...subunit delta 2.4 2.2 AL066_25950 Hypothetical protein 2.4 1.0 AL066_07605 ABC transporter permease 2.1 1.1 AL066_04890 Antibiotic synthesis protein MbtH 2.1 2.3 AL066_08545 PseC, RND transporter 2.1 1.2 AL066_05775 Hypothetical protein 2.1 2.0 AL066_27365 Biotin synthase 2.1 1.2 AL066_11260 Cytochrome C 2.2 1.5 AL066_07745 Beta-lactamase 2.2...”

PFL_4178 MbtH-like protein-related protein from Pseudomonas fluorescens Pf-5
89% identity, 99% coverage

• The effect of iron limitation on the transcriptome and proteome of Pseudomonas fluorescens Pf-5
  Lim, PloS one 2012
  • “...1.17 PFL_4169 PepSY-associated TM helix domain protein 2.39 1.48 PFL_4171 conserved hypothetical protein 1.44 NS PFL_4178 MbtH-like protein 3.99 4.73 FL_4189 non-ribosomal peptide synthetase PvdL 2.59 NS FL_4190 polymerase sigma-70 factor, ECF subfamily, PvdS 5.07 3.94 Enantio-pyochelin biosynthesis gene cluster FL_3483 RNA polymerase sigma-70 factor, ECF...”

Avin_25630 MbtH-like protein from Azotobacter vinelandii AvOP
89% identity, 89% coverage

• Transcriptional Analysis of an Ammonium-Excreting Strain of Azotobacter vinelandii Deregulated for Nitrogen Fixation
  Barney, Applied and environmental microbiology 2017
  • “...through Avin_25660), especially for the small mbtH-like gene (Avin_25630) (see Fig. 7). In addition to this cluster of genes, an additional cluster of genes...”

PP3808, PP_3808 conserved hypothetical protein from Pseudomonas putida KT2440
85% identity, 96% coverage

• In-Situ Purification of Non-Ribosomal Peptide Synthetases Assembly Line for Structural and Biochemical Studies
  Cao, International journal of molecular sciences 2025 (no snippet)
• Reliable Genomic Integration Sites in Pseudomonas putida Identified by Two-Dimensional Transcriptome Analysis
  Köbbing, ACS synthetic biology 2024
  • “...high mean RPKM values across cultivation conditions. We have chosen integration sites next to PP_2322, PP_3808, and PP_4709 ( Table 1 ). The highest mean RPKM values were found for 16S rRNA genes, but these sites were omitted for the above-mentioned reasons. In summary, we mined...”
  • “...tested similarly ( Figure 3 ). While the tested sensor constructs in site PP_2322 and PP_3808 reached similar activities to P. putida KT2440 att Tn7::sensor, P. putida KT2440 PP_4709_sensor achieved a higher activity ( Supporting Figure 8 ) and thus the highest activity found in this...”
• Stepwise genetic engineering of Pseudomonas putida enables robust heterologous production of prodigiosin and glidobactin A
  Cook, Metabolic engineering 2021
  • “...( Imker et al., 2010 ). The genome of P. putida KT2440 contains one gene (PP_3808) encoding an MLP specific for the NRPSs responsible for pyoverdine biosynthesis. Deleting the gene encoding P. putida s native MLP in strain GLB03 (resulting in GLB04) did not significantly change...”
  • “...than 2-fold increase in glidobactin A production compared to GLB03 and GLB04. In contrast, deleting PP_3808 or overexpressing glbE on a plasmid did not have a noticeable effect on glidobactin production for strain LUM01 ( Fig. S8b , c ). After demonstrating that expression of glbE...”

jpw_15990 MbtH family protein from Pseudomonas asiatica
85% identity, 96% coverage

• Genomic Analysis of Pseudomonas asiatica JP233: An Efficient Phosphate-Solubilizing Bacterium
  Wang, Genes 2022
  • “...PvdH (jpw_17620) and PvdA (jpw_15930) produces rare amino acids for the growing peptide; (iii) MbtH (jpw_15990) and the thioesterase (jpw_15985) are implied to act as auxiliary enzymes in PVD production; (iv) PvdE (jpw_19220) is an ABC transporter responsible for translocating the PVD precursor into the periplasm;...”
  • “...aspartate aminotransferase family protein jpw_15930 pvdA lysine N (6)-hydroxylase/ l -ornithine N (5)-oxygenase family protein jpw_15990 mbtH MbtH family protein jpw_15985 thioesterase jpw_19220 pvdE cyclic peptide export ABC transporter jpw_19155 pvdO formylglycine-generating enzyme family protein jpw_17595 pvdP hypothetical protein jpw_17600 pvdM pyoverdine-tailoring dipeptidase-like protein PvdM jpw_17605...”

JNO42_04010 MbtH family protein from Pseudomonas putida
83% identity, 96% coverage

• Plant growth-promoting effect and genomic analysis of the P. putida LWPZF isolated from C. japonicum rhizosphere
  Jin, AMB Express 2022
  • “...from the peripheral cytoplasm to the extracellular milieu (Imperi et al. 2009 ); (viii) mbtH (JNO42_04010) associated with NRPSs of cytoplasmic ferribactin synthesis (Felnagle et al. 2010 ); (ix) One thioesterase gene (JNO42_04015) that may participate in the manufacture of the initial dipeptide during the chromophores...”

PA14_33510 putative MbtH-like protein from Pseudomonas aeruginosa UCBPP-PA14
NP_251102 hypothetical protein from Pseudomonas aeruginosa PAO1
Q9I169 MbtH-like domain-containing protein from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
PA2412 hypothetical protein from Pseudomonas aeruginosa PAO1
78% identity, 96% coverage

• Parallel evolutionary paths to produce more than one Pseudomonas aeruginosa biofilm phenotype
  Thöming, NPJ biofilms and microbiomes 2020
  • “...PA14_56780 PA4366 sodB 2.6 PA14_33500 PA2413 pvdH 3.0 PA14_52960 PA0874 2.7 PA14_57020 PA4386 groES 2.7 PA14_33510 PA2412 3.5 PA14_53300 PA0848 3.4 PA14_60570 PA4578 2.9 PA14_33520 PA2411 3.7 PA14_55500 PA0680 hxcV 2.6 PA14_61650 PA4661 pagL 2.7 PA14_33600 PA2403 fpvG 3.1 PA14_56770 PA4365 2.5 PA14_64480 PA4876 osmE 2.7...”
• Enzyme-Mediated Quenching of the Pseudomonas Quinolone Signal (PQS) Promotes Biofilm Formation of Pseudomonas aeruginosa by Increasing Iron Availability
  Tettmann, Frontiers in microbiology 2016
  • “...binding site a PA2402 PA14_33610 3.9 Probable non-ribosomal peptide synthetase PvdS binding site a PA2412 PA14_33510 5.8 Conserved hypothetical protein Operon 2411-2412: PvdS binding site a PA2424 PA14_33280 7.9 pvdL Peptide synthase PvdL PvdS binding site a PA2426 PA14_33260 7.0 pvdS RNA polymerase ECF-subfamily sigma-70 factor...”
• Unveiling the Microbiome Landscape: A Metagenomic Study of Bacterial Diversity, Antibiotic Resistance, and Virulence Factors in the Sediments of the River Ganga, India
  Rout, Antibiotics (Basel, Switzerland) 2023
  • “...fptA contigs_76423 Bagwan BAA94855 astA contigs_2 Rasulabad Ghat NP_253699 waaF contigs_45; contigs_269352 Rasulabad Ghat; Sahidabad NP_251102 mbtH-like contigs_627 Bagwan AAF37887 ompA contigs_5362 Bagwan NP_252241 algA contigs_665 Rasulabad Ghat NP_252918 pchD Pyochelin (VF0095) ( Pseudomonas aeruginosa ) contigs_665 Rasulabad Ghat NP_252919 pchC contigs_665 Rasulabad Ghat NP_252914 pchG...”
• Proteome-wide identification of druggable targets and inhibitors for multidrug-resistant <i>Pseudomonas aeruginosa</i> using an integrative subtractive proteomics and virtual screening approach
  Vemula, Heliyon 2025
• Stuffed Methyltransferase Catalyzes the Penultimate Step of Pyochelin Biosynthesis
  Ronnebaum, Biochemistry 2019
  • “...showing that only the desired mutations were present. Pa2412 Overexpression Plasmid. The pa2412 (Uni-Prot ID Q9I169) overexpression plasmid was a gift from the laboratory of Andrew Gulick. 28 PA2412 is an MbtH-like protein (MLP) that increases P. aeruginosa NRPS protein expression including PchF (data not shown)....”
• Using MbtH-Like Proteins to Alter the Substrate Profile of a Nonribosomal Peptide Adenylation Enzyme.
  Mori, Chembiochem : a European journal of chemical biology 2018
  • “...Q9F8V3 (CouY), P9WIP4 (MbtH), Q73XY9 (MypaAaA), A8CF84 (KtzJ), Q333U6 (TioT), Q0X0B7 (Ecm8), B1MAR0 (MyabAaA), and Q9I169 (PA2412). Supplementary Material Supporting Information Acknowledgements This work was supported by a NSF CAREER Award MCB-1149427 (to S.G.-T.), the Department of Pharmaceutical Sciences (to S.G.-T.) and the Department of Molecular...”
• Molecular cloning, sequence analysis, and heterologous expression of the phosphinothricin tripeptide biosynthetic gene cluster from Streptomyces viridochromogenes DSM 40736
  Blodgett, Antimicrobial agents and chemotherapy 2005
  • “...(Q9KWY9) Pseudomonas aeruginosa putative MbtH-like protein (Q9I169) S. viridochromogenes peptide synthetase III (Q9KWY8) S. viridochromogenes putative protein...”
• In-Situ Purification of Non-Ribosomal Peptide Synthetases Assembly Line for Structural and Biochemical Studies
  Cao, International journal of molecular sciences 2025 (no snippet)
• Complete genome analysis of sugarcane root associated endophytic diazotroph Pseudomonas aeruginosa DJ06 revealing versatile molecular mechanism involved in sugarcane development
  Guo, Frontiers in microbiology 2023
  • “...- 36618633662819, + fhuE TonB-dependent siderophore receptor - 41243414121894, - mbtH Chain X, Hypothetical Protein Pa2412 - 41605754160357, - - Outer membrane receptor protein, mostly Fe transport - 42589734256511, - fepA Siderophore enterobactin receptor PfeA - 45678824570122, + pfeE Ferric enterobactin esterase PfeE 3.1.1.108 45701424571056, +...”
• Structural advances toward understanding the catalytic activity and conformational dynamics of modular nonribosomal peptide synthetases
  Patel, Natural product reports 2023
  • “...in which they are genetically encoded. 134,135 Structures of MLP proteins were determined including the PA2412 protein from the pyoverdine biosynthetic pathway (PDB 2PST) and MbtH (PDB 2KHR), illustrating a small core -sheet with a long -helix that packed against the sheet ( Fig. 3A )....”
  • “...of NRPS proteins. Fig. 3 MLP domains interact with adenylation domains. (A) The structure of PA2412 (PDB 2PST), the MLP from pyoverdine biosynthesis, illustrating the conserved tryptophan residues. (B). The structure of the SlgN1 adenylation domain (PDB 4GR5), which contains an MLP natively fused at its...”
• Machine learning from Pseudomonas aeruginosa transcriptomes identifies independently modulated sets of genes associated with known transcriptional regulators
  Rajput, Nucleic acids research 2022
  • “...genes, such as PA2531, PA4709, phuR , opmQ , pvdT , pvdR , pvdE and PA2412 are shared between the PvdS and Uncharacterized-13 iModulons ( Supplementary Figure S7D ). Thus, our analysis provides insight into the interconnectedness of iron acquisition systems in P. aeruginosa . iModulons...”
• Pf4 Phage Variant Infection Reduces Virulence-Associated Traits in Pseudomonas aeruginosa
  Tortuel, Microbiology spectrum 2022
  • “...SigX, FpvI 5.99 PA2410 fpvF FpvF PvdS, SigX, FpvI 4.65 PA2411 Probable thioesterase PvdS 5.10 PA2412 mbtH Conserved hypothetical protein PvdS 5.26 PA2413 pvdH l -2,4-Diaminobutyrate:2-ketoglutarate 4-aminotransferase, PvdH PvdS 3.85 PA2424 pvdL PvdL PvdS, RpoS 6.54 PA2425 pvdG PvdG PvdS, RpoS 6.67 PA2426 pvdS Sigma factor...”
• Dynamic Adaptive Response of Pseudomonas aeruginosa to Clindamycin/Rifampicin-Impregnated Catheters
  Sung, Antibiotics (Basel, Switzerland) 2021
  • “...DR97_4587, xcpT: DR97_4832 and popB: yopB. Proteins STRING could not find in the database: PA1096, PA2412, PA2393, PA3352, pvdP, tagQ1 and tssB1. ( C ) Proteinprotein interaction network analysis of DEPs associated with antibiotic resistance of biofilm cells grown with control and antibiotic-impregnated catheters using STRING....”
  • “...pvdF Pyoverdine synthetase PvdF, N5-hydroxyornithine formyltransferase 1.05 PA2398 fpvA Outer membrane ferripyoverdine receptor FpvA 1000.00 PA2412 MbtH-like NRPS chaperone 1000.00 PA2424 pvdL Pyoverdine chromophore precursor synthetase PvdL 0.00 PA3101 xcpT General secretion pathway protein G 0.32 PA3104 xcpP General secretion pathway protein C 0.00 PA3115 fimV...”
• Functional Cross-Talk of MbtH-Like Proteins During Thaxtomin Biosynthesis in the Potato Common Scab Pathogen Streptomyces scabiei
  Li, Frontiers in microbiology 2020
  • “...sequences of the MLP-encoding genes MXAN_3118 (from Myxococcus xanthus DK1622), RHA1_ro04717 (from Rhodococcus jostii RHA1), PA2412 (from Pseudomonas aeruginosa PA01), and ybdZ [from E. coli BL21(DE3)] were codon optimized for expression in Streptomyces using a webserver 1 from Integrated DNA Technologies (Coralville, IA, United States). The...”
  • “...bp insert of the MXAN_3118 gene with flanking regions Amp R This study pGEM-T EASY/ PA2412 pGEM-T EASY derivative containing a 309 bp insert of the PA2412 gene with flanking regions Amp R This study pGEM-T EASY/ RHA1_ro04717 pGEM-T EASY derivative containing a 342 bp insert...”
• Trophic cooperation promotes bacterial survival of Staphylococcus aureus and Pseudomonas aeruginosa
  Camus, The ISME journal 2020
  • “...and three genes encoding membrane and virulence factors (rfaD, PA2412 and cdrA) were dysregulated in the presence of S. aureus. More genes were affected during...”
• More

Hsero_2339 MbtH family protein from Herbaspirillum seropedicae SmR1
69% identity, 93% coverage

• Herbaspirillum seropedicae Differentially Expressed Genes in Response to Iron Availability
  Trovero, Frontiers in microbiology 2018
  • “...the same site of plasmid pCPP30 ( Huang et al., 1992 ). To obtain a Hsero_2339 mutant construct, pfrI gene was amplified with Pfu polymerase using primers PfrI1 and PfrI2 and cloned in the EcoRV site of pBluescript SK+ (pB pfrI ). A lacZaacC1 cassette was...”
  • “...pAB2001 with SmaI and cloned in an EcoRV site present in the middle of gene Hsero_2339 (pB pfrI::lacZaacC1 ). A BamHI-HindIII fragment from this construct containing the interrupted gene was cloned in the same site of pAB2002 (pA2 pfrI::lacZaacC1 ), and finally this plasmid was digested...”

HW44_RS01565 MbtH family protein from Nitrosococcus oceani
64% identity, 78% coverage

• High Synteny and Sequence Identity between Genomes of Nitrosococcus oceani Strains Isolated from Different Oceanic Gyres Reveals Genome Economization and Autochthonous Clonal Evolution
  Wang, Microorganisms 2020
  • “...to AFC132 is the existence of a putative MbtH-family nonribosomal peptide synthetase (NRPS) gene cluster (HW44_RS01565 (344,153344,419)) encoding the capacity for siderophore production. The other N. oceani genomes only contained pertinent genes required for uptake and processing of the cognate siderophore but not its synthesis. One...”
  • “..., NiFe-hydrogenase metallocenter assembly protein HypFCDE on AFC132 contig_122 (3,080,4913,085,122); , MbtH family NRPS protein HW44_RS01565 (344,153344,419). Figure 3 Inferred phylogenetic relationships among the five investigated strains of Nitrosococcus oceani based on one of their two identical 16S rRNA gene sequences in the context of Chromatiales...”

BCAL1689 MbtH-like protein from Burkholderia cenocepacia J2315
59% identity, 89% coverage

• Transcriptional response of Burkholderia cenocepacia J2315 sessile cells to treatments with high doses of hydrogen peroxide and sodium hypochlorite
  Peeters, BMC genomics 2010
  • “...Putative RNA polymerase 70 factor ( orbS ) 6.4 NS IG1_1847123 IG between BCAL1688 and BCAL1689 2.9 NS BCAL1689 Mbt-like protein ( orbH ) 3.8 NS BCAL1690 Dioxygenase ( orbG ) 2.3 NS BCAL2192 Conserved hypothetical protein ( iscX ) 2.4 NS BCAL2193 Ferredoxin ( fdx...”
  • “...transcription of orbS , two of the genes belonging to the ornibactin gene cluster, orbH (BCAL1689) and orbG (BCAL1690), were also found to be upregulated (Table 3 ). The IG sequence between orbS and orbH also showed elevated expression (Table 3 ). However, none of the...”
• Reciprocal regulation by the CepIR and CciIR quorum sensing systems in Burkholderia cenocepacia
  O'Grady, BMC genomics 2009
  • “...type-1 fimbrial protein -2.3 3.1 NC BCAL1688 sigma factor 70 EcfI (OrbS) NC -2.5 NC BCAL1689 MbtH-like protein OrbH NC -2.2 NC BCAL1690 putative dioxygenase OrbG NC NC 2.5 BCAL1692 iron transport-related membrane protein OrbD NC NC 3.0 BCAL1693 iron transport-related membrane protein OrbF NC NC...”

MXAN_3118 MbtH-like domain protein from Myxococcus xanthus DK 1622
MXAN_RS15115, WP_011553168 MbtH family protein from Myxococcus xanthus DZ2
69% identity, 85% coverage

• Functional Cross-Talk of MbtH-Like Proteins During Thaxtomin Biosynthesis in the Potato Common Scab Pathogen Streptomyces scabiei
  Li, Frontiers in microbiology 2020
  • “...as per the manufacturers protocol (QIAgen Inc, Canada). The nucleotide sequences of the MLP-encoding genes MXAN_3118 (from Myxococcus xanthus DK1622), RHA1_ro04717 (from Rhodococcus jostii RHA1), PA2412 (from Pseudomonas aeruginosa PA01), and ybdZ [from E. coli BL21(DE3)] were codon optimized for expression in Streptomyces using a webserver...”
  • “...bp insert of the cloY gene with flanking regions Amp R This study pGEM-T EASY/ MXAN_3118 pGEM-T EASY derivative containing a 306 bp insert of the MXAN_3118 gene with flanking regions Amp R This study pGEM-T EASY/ PA2412 pGEM-T EASY derivative containing a 309 bp insert...”
• Bacterial MbtH-like Proteins Stimulate Nonribosomal Peptide Synthetase-Derived Secondary Metabolism in Filamentous Fungi
  Zwahlen, ACS synthetic biology 2019
  • “...to test in future studies for their applicability in fungal hosts would be the MLP MXAN_3118 found in Myxococcus xanthus DK1622. 48 MXAN_3118 is not associated with a NRPS BGC but was found to interact with seven different NRPS enzymes, making MXAN_3118 a promising universal MLP....”
• TxtH is a key component of the thaxtomin biosynthetic machinery in the potato common scab pathogen Streptomyces scabies
  Li, Molecular plant pathology 2019
  • “...cluster that synthesizes the siderophore scabichelin (Kodani et al ., 2013 ). An orphan MLP (MXAN_3118) from Myxococcus xanthus DK 1622 showed the least amino acid identity (33.8%) with TxtH in the pairwise comparison (Table S2 ). A recent study showed that MXAN_3118, which is not...”
• An Orphan MbtH-Like Protein Interacts with Multiple Nonribosomal Peptide Synthetases in Myxococcus xanthus DK1622
  Esquilín-Lebrón, Journal of bacteriology 2018
  • “...peptide biosynthesis. We targeted the orphan 24 MLP MXAN_3118 from Myxococcus xanthus DK1622 for characterization. The M. 25 xanthus DK1622 genome contains...”
  • “...on September 6, 2018 by guest 4 encoding gene (MXAN_3118). We tested the hypothesis that MXAN_3118 interacts with 27 one or more NRPS using a combination of...”
• Characterization of the Functional Variance in MbtH-like Protein Interactions with a Nonribosomal Peptide Synthetase
  Schomer, Biochemistry 2017
  • “...and inserts are listed in Supplementary Table 2 . Genes coding for MbtH, PA2412, Atu3678, MXAN_3118, BSU31959, CmnN, and VioN were cloned into pBAD33 with the ribosome binding site of pET37B. 1 These constructs control the expression of these genes by an arabinose-inducible promotor. 21 These...”
  • “...cleavage site in between the peptide and an N-terminal H6-tag. 22 PA2412, Atu3878, BSU31959, and MXAN_3118 were cloned into pACYC-duet-1 for overexpression of an untagged protein. Additional plasmids are referenced in Table S3 . We note that a recent reconstruction of the Myxococcus xanthus DK1622 genome...”
• Biotechnological production optimization of argyrins - a potent immunomodulatory natural product class
  Pogorevc, Microbial biotechnology 2022
  • “...data), which already contained a geneencoding MbtHlike protein homologue from M. xanthus (NCBI locus tag: MXAN_RS15115), to be coexpressed [without the histidine (his) tag] together with the APCP protein. The resulting pETDuet1_MXAN_3118argM4APCP plasmid was transformed into an E.coli BL21 (DE3) for protein expression and a single...”
• An Orphan MbtH-Like Protein Interacts with Multiple Nonribosomal Peptide Synthetases in Myxococcus xanthus DK1622.
  Esquilín-Lebrón, Journal of bacteriology 2018
  • GeneRIF: MXAN_3118 is the first MbtH-like protein to be identified that naturally interacts with multiple nonribosomal peptide synthetases systems in a single organism.
• Characterization of the Functional Variance in MbtH-like Protein Interactions with a Nonribosomal Peptide Synthetase
  Schomer, Biochemistry 2017
  • “...DK1622 genome has renamed the locus tags for this bacterium and MXAN_3118 has been renamed MXAN_RS15115. However, at the time of submission, there was no NCBI database entry for MXAN_RS15115. For this reason, we continue to refer to this MLP as MXAN_3118 in this work. Construction...”

AA671_12395 MbtH family protein from Delftia tsuruhatensis
61% identity, 78% coverage

• Draft Genome Sequence of Delftia tsuruhatensis MTQ3, a Strain of Plant Growth-Promoting Rhizobacterium with Antimicrobial Activity
  Hou, Genome announcements 2015
  • “...(AA671_02705), polyketide synthase (PKS) gene (AA671_12420), nonribosomal peptide synthetase (NRPS) gene (AA671_12430), balhimycin synthesis gene (AA671_12395), quinolinate synthesis gene (AA671_01765), and phenazine synthesis gene (AA671_00865). Some genes responsible for the processing and transport of antibiotics were identified in the genome, including antibiotic biosynthesis monooxygenase gene (AA671_01400,...”

Atu3678 putative siderophore biosynthesis protein from Agrobacterium tumefaciens str. C58 (Cereon)
58% identity, 91% coverage

• Characterization of the Functional Variance in MbtH-like Protein Interactions with a Nonribosomal Peptide Synthetase
  Schomer, Biochemistry 2017
  • “...vectors and inserts are listed in Supplementary Table 2 . Genes coding for MbtH, PA2412, Atu3678, MXAN_3118, BSU31959, CmnN, and VioN were cloned into pBAD33 with the ribosome binding site of pET37B. 1 These constructs control the expression of these genes by an arabinose-inducible promotor. 21...”
  • “...BW27783 or BW27783 ybdZ was transformed with pBAD33 or pBAD33 containing ybdZ, mbtH , PA2412, Atu3678, MXAN_3118, BSU31959, cmnN , or vioN . For all growth curves, each strain was grown in triplicate in LB with 34 g mL 1 chloramphenicol for 8 h at 30...”

Avin_50380 MbtH-like protein from Azotobacter vinelandii AvOP
59% identity, 84% coverage

• Transcriptional Analysis of an Ammonium-Excreting Strain of Azotobacter vinelandii Deregulated for Nitrogen Fixation
  Barney, Applied and environmental microbiology 2017
  • “...encoding several siderophore-related proteins (Avin_50350 to Avin_50380), and a gene encoding a molybdenum transporter (Avin_50670). Other genes transcribed...”
  • “...with siderophores in A. vinelandii (Avin_50330 to Avin_50380) (not shown) was also transcribed at elevated levels (Table 2). Results presented represent...”

Achr_39010 MbtH family protein from Azotobacter chroococcum NCIMB 8003
54% identity, 87% coverage

• Azotobacter Genomes: The Genome of Azotobacter chroococcum NCIMB 8003 (ATCC 4412)
  Robson, PloS one 2015
  • “...genes potentially for Fe uptake and the synthesis and export of a non-ribosomal peptide siderophore (Achr_39010 to 38860) discussed further below. The comparable location in Av-DJ contains a 3 gene operon potentially encoding an ABC-type ferrichrome transporter (Avin_39050 to 39030) and is followed by genes not...”
  • “...siderophore receptors and a Sigma 70 factor. Apart for a gene encoding an MbtH-like protein (Achr_39010) none of the proteins encoded in this cluster show strong identity to any gene in Av-DJ. Instead, they show at least 60% identity to orthologs from a variety of -proteobacterial...”

A8CF84 KtzJ from Kutzneria sp. (strain 744)
56% identity, 84% coverage

• Using MbtH-Like Proteins to Alter the Substrate Profile of a Nonribosomal Peptide Adenylation Enzyme
  Mori, Chembiochem : a European journal of chemical biology 2018
  • “...were A0QF81 (MyavAaA), A0QHN9 (MyavAcA), Q3L893 (MysmAbA), B2HHJ4 (MymaAcA), Q9F8V3 (CouY), P9WIP4 (MbtH), Q73XY9 (MypaAaA), A8CF84 (KtzJ), Q333U6 (TioT), Q0X0B7 (Ecm8), B1MAR0 (MyabAaA), and Q9I169 (PA2412). Supplementary Material Supporting Information Acknowledgements This work was supported by a NSF CAREER Award MCB-1149427 (to S.G.-T.), the Department of...”

BTH_I2426 mbtH-like protein from Burkholderia thailandensis E264
65% identity, 63% coverage

• The Global Regulator MftR Controls Virulence and Siderophore Production in Burkholderia thailandensis
  Thapa, Journal of bacteriology 2022 (secret)

XALc_1065 putative mbth-like protein from Xanthomonas albilineans
52% identity, 100% coverage

• Genome mining reveals the genus Xanthomonas to be a promising reservoir for new bioactive non-ribosomally synthesized peptides
  Royer, BMC genomics 2013
  • “...locus encodes an ABC transporter (XALc_1064), an AraC transcriptional regulator (XALc_1054) and a MbtH-like protein (XALc_1065). The ABC transporter likely is the corresponding transporter for secretion of small molecule(s) synthesized by META-B. The AraC protein may be required for specific transcriptional regulation of genes present in...”

BPSL1786 conserved hypothetical protein from Burkholderia pseudomallei K96243
65% identity, 65% coverage

• Burkholderia thailandensis strain E555 is a surrogate for the investigation of Burkholderia pseudomallei replication and survival in macrophages
  Kovacs-Simon, BMC microbiology 2019
  • “...type VI secretion system protein TssJ-5 Yes Yes 3092 6.1826 hypothetical MbtH-like protein, PA2412 homolog BPSL1786 hypothetical protein Yes No 5927 6.1495 DNA-binding response regulator BPSS1522 bprB two-component response regulator Yes No Known virulence factors of B. pseudomallei are shown in bold in the first column...”
• Molecular basis of rare aminoglycoside susceptibility and pathogenesis of Burkholderia pseudomallei clinical isolates from Thailand
  Trunck, PLoS neglected tropical diseases 2009
  • “...Putative iron transport-related ATP-binding protein BPSL1785 Hypothetical protein (similar to syrP from Streptomyces verticillus ) BPSL1786 Hypothetical protein (similar to mbtH from Mycobacterium tuberculosis ) mbaS MbaS, extracytoplasmic sigma factor BPSL1788 Pseudogene BPSL1789 Short chain dehydrogenase BPSL1790 Putative zinc-binding dehydrogenase BPSL1791 Hypothetical protein BPSL1792 Hypothetical protein...”

W7IRY5 MbtH protein from Actinokineospora spheciospongiae
59% identity, 84% coverage

• Metabologenomics: Correlation of Microbial Gene Clusters with Metabolites Drives Discovery of a Nonribosomal Peptide with an Unusual Amino Acid Monomer.
  Goering, ACS central science 2016
  • “...(55) tbrF 249 NRPS (TE) thioesterase A0A077JC92 109/237 (46) tbrG 60 mbth putative MbtH-like protein W7IRY5 33/54 (61) tbrH 405 cytochrome p450 (tryptophan oxygenase) cytochrome P450 NovI Q9L9F9 140/400 (35) tbrI 1313 NRPS (A-T-Cyc-Mt) (Cl-indole-acid) nonribosomal peptide synthetase A0A077JBM3 736/1319 (56) tbrJ 215 phosphopantetheinyl transferase 4-phosphopantetheinyl...”

AORI_1481 MbtH family protein from Amycolatopsis keratiniphila
57% identity, 84% coverage

• Complete genome sequence and comparative genomic analyses of the vancomycin-producing Amycolatopsis orientalis
  Xu, BMC genomics 2014
  • “...81.31 AORI_1479 vcmB Non-ribosomal peptide synthetase lcl|AJ223999.1_cdsid_CAA11795.1 82.34 AORI_1480 vcmC Non-ribosomal peptide synthetase lcl|Y16952.3_cdsid_CAC48362.1 86.81 AORI_1481 mbtH MbtH protein lcl|Y16952.3_cdsid_CAC48363.1 89.86 AORI_1482 oxyA Cytochrome P450 lcl|Y16952.3_cdsid_CAA76547.1 86.19 AORI_1483 oxyB Cytochrome P450 lcl|Y16952.3_cdsid_CAA76548.1 87.44 AORI_1484 oxyC Cytochrome P450 lcl|AJ223998.1_cdsid_CAA11791.1 91.69 AORI_1485 vhal Halogenase lcl|Y16952.3_cdsid_CAA76550.1 93.89 AORI_1486 gtfD...”

AWZ11_RS05060 MbtH family protein from Streptomyces europaeiscabiei
56% identity, 81% coverage

• Functional Cross-Talk of MbtH-Like Proteins During Thaxtomin Biosynthesis in the Potato Common Scab Pathogen Streptomyces scabiei
  Li, Frontiers in microbiology 2020
  • “...n/a Bown and Bignell, 2017 Streptomyces europaeiscabiei 89-04 Source of genomic DNA for amplifying the AWZ11_RS05060 coding sequence n/a Zhang et al., 2016 Streptomyces clavuligerus ATCC27064 Wild-type strain n/a ATCC Apra R , Kan R , Cml R , and Hyg R = apramycin, kanamycin, chloramphenicol...”
  • “...for expression of the HIS 6 -CGL27_RS02360 protein Kan R This study pET28b/HIS 6 - AWZ11_RS05060 pET28b derivative containing a DNA fragment for expression of the HIS 6 -AWZ11_RS05060 protein Kan R This study pET28b/HIS 6 - comB pET28b derivative containing a DNA fragment for expression...”

YP_640626 MbtH-like protein from Mycobacterium sp. MCS
53% identity, 88% coverage

• Identification and characterization of the biosynthetic gene cluster of polyoxypeptin A, a potent apoptosis inducer
  Du, BMC microbiology 2014
  • “...NRRL 15998 75/87 orf10 303 ZP_04706923 Pyruvate dehydrogenase Streptomyces roseosporus NRRL 11379 74/84 plyA 71 YP_640626 MbtH-like protein Mycobacterium sp. MCS 80/87 plyB 225 YP_712760 Putative regulator Frankia alni ACN14a 76/84 plyC 528 YP_712761 A Frankia alni ACN14a 77/85 plyD 77 YP_712762 PCP Frankia alni ACN14a...”

Q93N85 MbtH-like domain-containing protein from Streptomyces lavendulae
47% identity, 97% coverage

• Bacterial MbtH-like Proteins Stimulate Nonribosomal Peptide Synthetase-Derived Secondary Metabolism in Filamentous Fungi
  Zwahlen, ACS synthetic biology 2019
  • “...Tested in This Study a name UniProt organism biosynthetic gene cluster GenBank ID reference ComB Q93N85 Streptomyces lavendulae Complestatine AF386507 ( 61 ) CdaI Q7BRC2 Streptomyces coelicolor Calcium dependent antibiotic AL939115 ( 62 ) Tcp13 Q70AZ5 Actinoplanes teichomyceticus Teicoplanin AJ605139 ( 63 ) Veg8 B7T1C1 uncultured...”

Q333U6 MbtH homologue from Micromonospora sp. ML1
56% identity, 84% coverage

• Using MbtH-Like Proteins to Alter the Substrate Profile of a Nonribosomal Peptide Adenylation Enzyme.
  Mori, Chembiochem : a European journal of chemical biology 2018
  • “...(MyavAaA), A0QHN9 (MyavAcA), Q3L893 (MysmAbA), B2HHJ4 (MymaAcA), Q9F8V3 (CouY), P9WIP4 (MbtH), Q73XY9 (MypaAaA), A8CF84 (KtzJ), Q333U6 (TioT), Q0X0B7 (Ecm8), B1MAR0 (MyabAaA), and Q9I169 (PA2412). Supplementary Material Supporting Information Acknowledgements This work was supported by a NSF CAREER Award MCB-1149427 (to S.G.-T.), the Department of Pharmaceutical Sciences...”

STRAU_RS01625 MbtH family protein from Streptomyces aurantiacus
52% identity, 88% coverage

• Allopeptimicins: unique antibacterial metabolites generated by hybrid PKS-NRPS, with original self-defense mechanism in Actinoallomurus
  Iorio, RSC advances 2022
  • “...[transcriptional regulator, asukamycin ( Streptomyces nodosus subsp. asukaensis , ADI58623.1)] 50% Regulatory AptX C 77 STRAU_RS01625 [MbtH family protein, aurantimycin A ( Streptomyces aurantiacus JA 4570, WP_016638464.1)] 73% MbtH-like protein AptR3 C 342 DtpR2 [streptomycin biosynthesis operon regulator, thiolutin ( Saccharothrix algeriensis , AJI44174.1)] 48% Regulatory...”

SCLAV_p1293 MbtH family protein from Streptomyces clavuligerus
58% identity, 83% coverage

• Functional Cross-Talk of MbtH-Like Proteins During Thaxtomin Biosynthesis in the Potato Common Scab Pathogen Streptomyces scabiei
  Li, Frontiers in microbiology 2020
  • “...for expression of the HIS 6 -CchK protein Kan R This study pET28b/HIS 6 - SCLAV_p1293 pET28b derivative containing a DNA fragment for expression of the HIS 6 -SCLAV_p1293 protein Kan R This study pET28b/HIS 6 - ybdZ pET28b derivative containing a DNA fragment for expression...”
  • “...replaced with the S. coelicolor cchK gene Apra R , Kan R This study pRFSRL16/ SCLAV_p1293 pRFSRL16 derivative in which egfp is replaced with the S. clavuligerus SCLAV_p1293 gene Apra R , Kan R This study pRFSRL16/ ybdZ pRFSRL16 derivative in which egfp is replaced with...”

Q9F8V3 CouY from Streptomyces rishiriensis
45% identity, 92% coverage

• Using MbtH-Like Proteins to Alter the Substrate Profile of a Nonribosomal Peptide Adenylation Enzyme
  Mori, Chembiochem : a European journal of chemical biology 2018
  • “...UniProt IDs for the MLPs studied were A0QF81 (MyavAaA), A0QHN9 (MyavAcA), Q3L893 (MysmAbA), B2HHJ4 (MymaAcA), Q9F8V3 (CouY), P9WIP4 (MbtH), Q73XY9 (MypaAaA), A8CF84 (KtzJ), Q333U6 (TioT), Q0X0B7 (Ecm8), B1MAR0 (MyabAaA), and Q9I169 (PA2412). Supplementary Material Supporting Information Acknowledgements This work was supported by a NSF CAREER Award...”

ADK37_26530 MbtH family protein from Streptomyces resistomycificus
52% identity, 88% coverage

• Characterization of the aurantimycin biosynthetic gene cluster and enhancing its production by manipulating two pathway-specific activators in Streptomyces aurantiacus JA 4570
  Zhao, Microbial cell factories 2016
  • “...Orf10 279 KTF47288 3-Methyl-2-oxobutanoate dehydrogenase APS67_01220, Streptomyces sp. AVP053U2 86/91 ArtA 71 KOG32626 MbtH-like protein ADK37_26530, Streptomyces resistomycificus 87/94 ArtB 240 KUN90566 Putative regulator AQJ84_39630, Streptomyces resistomycificus 77/86 ArtC 530 KUM93570 A AQI88_26200, Streptomyces cellostaticus 84/90 ArtD 77 AKJ15824 PCP ABB07_39115, Streptomyces incarnatus 84/90 ArtE 395...”

RHA1_ro04717 conserved hypothetical protein, MbtH family from Rhodococcus sp. RHA1
47% identity, 89% coverage

• Functional Cross-Talk of MbtH-Like Proteins During Thaxtomin Biosynthesis in the Potato Common Scab Pathogen Streptomyces scabiei
  Li, Frontiers in microbiology 2020
  • “...(QIAgen Inc, Canada). The nucleotide sequences of the MLP-encoding genes MXAN_3118 (from Myxococcus xanthus DK1622), RHA1_ro04717 (from Rhodococcus jostii RHA1), PA2412 (from Pseudomonas aeruginosa PA01), and ybdZ [from E. coli BL21(DE3)] were codon optimized for expression in Streptomyces using a webserver 1 from Integrated DNA Technologies...”
  • “...bp insert of the PA2412 gene with flanking regions Amp R This study pGEM-T EASY/ RHA1_ro04717 pGEM-T EASY derivative containing a 342 bp insert of the RHA1_ro04717 gene with flanking regions Amp R This study pGEM-T EASY/ ybdZ pGEM-T EASY derivative containing a 300 bp insert...”

WP_109379533 MbtH family protein from Streptomyces sp. NWU339
52% identity, 88% coverage

• Analyzing and engineering of the biosynthetic pathway of mollemycin A for enhancing its production
  Jin, Synthetic and systems biotechnology 2024
  • “...subunit alpha Streptomyces sp. AVP053U2 ODA73935 79%/87% MomA 71 MbtH family protein Streptomyces sp. NWU339 WP_109379533 87%/95% MomC 519 amino acid adenylation domain-containing protein Streptomyces janthinus WP_193477339 80%/86% MomD 84 phosphopantetheine-binding protein Streptomyces sp. NWU339 PWI09282 83%/92% MomE 395 NAD(P)/FAD-dependent oxidoreductase Streptomyces phaeochromogenes WP_073491942 85%/92% MomF...”

Q0X0B7 MbtH family protein from Streptomyces lasalocidi
51% identity, 89% coverage

• Using MbtH-Like Proteins to Alter the Substrate Profile of a Nonribosomal Peptide Adenylation Enzyme
  Mori, Chembiochem : a European journal of chemical biology 2018
  • “...(MyavAcA), Q3L893 (MysmAbA), B2HHJ4 (MymaAcA), Q9F8V3 (CouY), P9WIP4 (MbtH), Q73XY9 (MypaAaA), A8CF84 (KtzJ), Q333U6 (TioT), Q0X0B7 (Ecm8), B1MAR0 (MyabAaA), and Q9I169 (PA2412). Supplementary Material Supporting Information Acknowledgements This work was supported by a NSF CAREER Award MCB-1149427 (to S.G.-T.), the Department of Pharmaceutical Sciences (to S.G.-T.)...”

Q70AZ5 MbtH-like short polypeptide from Actinoplanes teichomyceticus
45% identity, 92% coverage

• Resurrecting ancestral antibiotics: unveiling the origins of modern lipid II targeting glycopeptides
  Hansen, Nature communications 2023
  • “...co-transformed with a pCDF-1b construct encoding the MbtH-like protein Tcp13 from Actinoplanes teichomyceticus (Uniprot ID: Q70AZ5) into E. coli BL21 (DE3) cells. Cells were grown overnight at 37C with shaking in lysogeny broth (LB) medium (Miller et al. 1992) supplemented with 100g/mL ampicillin and streptomycin as...”
• Bacterial MbtH-like Proteins Stimulate Nonribosomal Peptide Synthetase-Derived Secondary Metabolism in Filamentous Fungi
  Zwahlen, ACS synthetic biology 2019
  • “...( 61 ) CdaI Q7BRC2 Streptomyces coelicolor Calcium dependent antibiotic AL939115 ( 62 ) Tcp13 Q70AZ5 Actinoplanes teichomyceticus Teicoplanin AJ605139 ( 63 ) Veg8 B7T1C1 uncultured soil bacterium putative (vancomycin-like eDNA derived gene cluster, VEG cluster) EU874252 ( 64 ) Teg7 B7T1D2 uncultured soil bacterium putative...”

MSMEG_4508 hypothetical protein from Mycobacterium smegmatis str. MC2 155
47% identity, 88% coverage

• Transcriptomic Profile of Mycobacterium smegmatis in Response to an Imidazo[1,2-b][1,2,4,5]tetrazine Reveals Its Possible Impact on Iron Metabolism
  Vatlin, Frontiers in microbiology 2021
  • “...7 MSMEG_0019 FxbB 7.0 8 MSMEG_0019 FxbC 7.7 9 MSMEG_0020 FxuD 5.7 Mbt-1 cluster 10 MSMEG_4508 MbtH 5.4 11 MSMEG_4509 MbtG 7.2 12 MSMEG_4510 MbtF 7.1 13 MSMEG_4511 MbtE 7.6 14 MSMEG_4512 MbtD 7.7 15 MSMEG_4513 MbtC 7.7 16 MSMEG_4514 MbtT 6.6 17 MSMEG_4515 MbtB 7.2...”
• Production of mycobacterial cell wall glycopeptidolipids requires a member of the MbtH-like protein family
  Tatham, BMC microbiology 2012
  • “...by mutational analysis that the mbtH orthologue in the mycobactin biosynthetic gene cluster of Ms (MSMEG_4508) is not essential for mycobactin production [ 35 ]. Similarly, the mbtH -like gene in the biosynthetic gene cluster of the balhimycin glycopeptide antibiotic has been shown not to be...”
  • “...pCP0 expressing M. smegmatis gplH This study pCP0- mbtH Ms pCP0 expressing M. smegmatis mbtH (MSMEG_4508) [ 35 ] p2NIL Kanamycin resistance gene and OriE [ 57 ] pGOAL19 Hygromycin resistance gene, sacB - lacZ Pac I cassette, and OriE [ 57 ] p2NIL-GOALc-gplHc Delivery vector...”
• Mutational and phylogenetic analyses of the mycobacterial mbt gene cluster
  Chavadi, Journal of bacteriology 2011
  • “...hydroxylase gene mbtG (msmeg_4509); and the gene mbtH (msmeg_4508) (36). The genes mbtI (encoding a salicylic acid synthase [12]) and mbtJ (encoding a putative...”

Q939Y8 MbtH-like domain-containing protein from Amycolatopsis balhimycina
52% identity, 84% coverage

• A proof-reading mechanism for non-proteinogenic amino acid incorporation into glycopeptide antibiotics
  Kaniusaite, Chemical science 2019
  • “...BpsB (UniProt code Q939Z0) module 6 (covering the A-PCP region) and MbtH-like protein (UniProt code Q939Y8) from the balhimycin biosynthesis gene cluster in Amycolatopsis balhimycina (DSM 44591) were obtained from Eurofins Genomics MWG. BpsB module 6 A-PCP construct was cloned into a modified pET vector (pET-MBP-1c...”

SCAB_3331 MbtH-like protein from Streptomyces scabiei 87.22
46% identity, 92% coverage

• Identification of Novel Rotihibin Analogues in Streptomyces scabies, Including Discovery of Its Biosynthetic Gene Cluster
  Planckaert, Microbiology spectrum 2021
  • “...SCAB_3301 RthJ Acyl-CoA dehydrogenase SCAB_3311 RthK Acyl carrier protein SCAB_3321 RthA Pentamodular nonribosomal peptide synthetase SCAB_3331 RthL MbtH-like protein SCAB_3341 RthM l -Asparagine oxygenase SCAB_3351 RthN Diaminobutyrate-2-oxoglutarate transaminase Analysis of the genes involved in the rotihibin BGC. (i) NRPS genes for peptide chain assembly. Two NRPSs,...”
• TxtH is a key component of the thaxtomin biosynthetic machinery in the potato common scab pathogen Streptomyces scabies
  Li, Molecular plant pathology 2019
  • “...genes appear to be pseudogenes. Two other MLPs encoded in the S. scabies 87.22 genome, SCAB_3331 (herein referred to as MLP lipo ) and SCAB_85461 (herein referred to as MLP scab ), both share only 52.3% amino acid identity with TxtH (Table S1 ) and cluster...”

Q3L893 Conserved domain protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
MSMEG_0399 hypothetical protein from Mycobacterium smegmatis str. MC2 155
46% identity, 89% coverage

• Using MbtH-Like Proteins to Alter the Substrate Profile of a Nonribosomal Peptide Adenylation Enzyme.
  Mori, Chembiochem : a European journal of chemical biology 2018
  • “...substitutions per site. The UniProt IDs for the MLPs studied were A0QF81 (MyavAaA), A0QHN9 (MyavAcA), Q3L893 (MysmAbA), B2HHJ4 (MymaAcA), Q9F8V3 (CouY), P9WIP4 (MbtH), Q73XY9 (MypaAaA), A8CF84 (KtzJ), Q333U6 (TioT), Q0X0B7 (Ecm8), B1MAR0 (MyabAaA), and Q9I169 (PA2412). Supplementary Material Supporting Information Acknowledgements This work was supported by...”
• Production of mycobacterial cell wall glycopeptidolipids requires a member of the MbtH-like protein family
  Tatham, BMC microbiology 2012
  • “...gplH encompassed 59 central amino acids of the predicted MbtH-like protein encoded by gplH (GplH, MSMEG_0399; 76 amino acids, Figure 3A ). The deletion was verified by PCR using primer pairs that produced amplicons of different sizes depending on whether the genomic DNA used as PCR...”
  • “..., 35 , 58 ]. A suicide delivery vector (p2NIL-GOALc-gplHc, see below) carrying a gplH (MSMEG_0399) deletion cassette (gplHc) was used to generate Ms gplH . The vector was electroporated into Ms and transformants with a potential p2NIL-GOALc-gplHc integration via a single-crossover event (blue colonies) were...”
• Mutational and phylogenetic analyses of the mycobacterial mbt gene cluster
  Chavadi, Journal of bacteriology 2011
  • “...siderophore exochelin MS (11, 50, 52). The second protein, MSMEG_0399 (71% amino acid sequence identity with M. smegmatis MbtH), is encoded by a gene clustered...”
  • “...38). Based on the genetic context, MSMEG_0016 and MSMEG_0399 are likely to be involved in exochelin MS and glycopeptidolipid production, respectively. It...”

XNR_3456 MbtH family protein from Streptomyces albidoflavus
42% identity, 87% coverage

• Comparative Genomics and Biosynthetic Cluster Analysis of Antifungal Secondary Metabolites of Three Strains of <i>Streptomyces albidoflavus</i> Isolated from Rhizospheric Soils
  Gonzalez-Silva, Microorganisms 2024
  • “...transporter ATP-binding protein (942 bp); 39. XNR_3455, ABC transport system membrane protein (798 bp); 40. XNR_3456, MbtH domain-containing protein (258 bp); 41. lipE , abhydrolase_6 biosynthetic-additional (810 bp), and 42. XNR_3458, succinate-semialdehyde dehydrogenase (1428 bp). Figure 7 Synteny of BGC of candicidin of S. albidoflavus and...”
  • “...transporter ATP-binding protein (942 bp); 39. XNR_3455, ABC transport system membrane protein (798 bp); 40. XNR_3456, MbtH domain-containing protein (258 bp); 41. lipE , abhydrolase_6 biosynthetic-additional (810 bp), and 42. XNR_3458, succinate-semialdehyde dehydrogenase (1428 bp). microorganisms-12-02637-t001_Table 1 Table 1 Average Nucleotide Identity by Orthology (OrthoANI) of...”

DMB42_RS42820 MbtH family protein from Nonomuraea sp. WAC 01424
51% identity, 84% coverage

• Genomic-Led Discovery of a Novel Glycopeptide Antibiotic by Nonomuraea coxensis DSM 45129
  Yushchuk, ACS chemical biology 2021
  • “...(13) (77%) NRPS modules456 nocD dbv16 (91.7%) DMB42_RS42825 (14) (79%) NRPS module7 noc19 dbv15 (94.2%) DMB42_RS42820 (15) (93%) MbtH-like protein noc20 dbv14 (91.8%) DMB42_RS42815 (16) (78%) cross-linking oxygenase (OxyA) noc21 dbv13 (89.8%) DMB42_RS42810 (17) (77%) cross-linking oxygenase (OxyC) noc22 dbv12 (93.5%) DMB42_RS42805 (18) (77%) cross-linking oxygenase...”

BCG_2391c putative protein mbtH from Mycobacterium bovis BCG str. Pasteur 1173P2
P9WIP4 Protein MbtH from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
45% identity, 92% coverage

• Comparison of the transcriptome, lipidome, and c-di-GMP production between BCGΔBCG1419c and BCG, with Mincle- and Myd88-dependent induction of proinflammatory cytokines in murine macrophages
  Flores-Valdez, Scientific reports 2024
  • “...0.020911838 EBG00001157315 EBG00001157315 5S_rRNA 1.05 0.031607557 BCG_2922c BCG_2922c Rv2901c Conserved hypothetical protein 1.0287 0.037531455 mbtH BCG_2391c Rv2377c Putative conserved protein mbtH 1.004 0.011346227 BCG_0026c BCG_0026c Rv3920c Hypothetical protein similar to jag protein 0.9649 0.02941768 phoY1_1 BCG_3330c Rv3301c Probable phosphate-transport system transcriptional regulatory protein phoU homolog 1...”
• Using MbtH-Like Proteins to Alter the Substrate Profile of a Nonribosomal Peptide Adenylation Enzyme
  Mori, Chembiochem : a European journal of chemical biology 2018
  • “...for the MLPs studied were A0QF81 (MyavAaA), A0QHN9 (MyavAcA), Q3L893 (MysmAbA), B2HHJ4 (MymaAcA), Q9F8V3 (CouY), P9WIP4 (MbtH), Q73XY9 (MypaAaA), A8CF84 (KtzJ), Q333U6 (TioT), Q0X0B7 (Ecm8), B1MAR0 (MyabAaA), and Q9I169 (PA2412). Supplementary Material Supporting Information Acknowledgements This work was supported by a NSF CAREER Award MCB-1149427 (to...”

SLUN_RS38480 MbtH family protein from Streptomyces lunaelactis
48% identity, 88% coverage

• Lunaemycins, New Cyclic Hexapeptide Antibiotics from the Cave Moonmilk-Dweller Streptomyces lunaelactis MM109^T
  Martinet, International journal of molecular sciences 2023
  • “...384 StenL, bifunctional N(2)-acetyl-L-ornithine:L-glutamate N-acetyltransferase (ArgJ), stenothricin BGC from Streptomyces roseosporus (EFE73304.1) 80/100 L-ornithine synthesis SLUN_RS38480 WP_108155200.1 Lun15 70 KtzJ, aurantimycin A BGC from Streptomyces aurantiacus JA 4570 (WP_016638464.1) 71/100 Building block modification SLUN_RS38485 WP_108155201.1 Lun16 444 HmtM, lysine N(6)-hydroxylase/L-ornithine N(5)-oxygenase, himastatin BGC of Streptomyces himastatinicus...”

B2HHJ4 Conserved hypothetical MbtH-like protein from Mycobacterium marinum (strain ATCC BAA-535 / M)
48% identity, 83% coverage

• Using MbtH-Like Proteins to Alter the Substrate Profile of a Nonribosomal Peptide Adenylation Enzyme
  Mori, Chembiochem : a European journal of chemical biology 2018
  • “...site. The UniProt IDs for the MLPs studied were A0QF81 (MyavAaA), A0QHN9 (MyavAcA), Q3L893 (MysmAbA), B2HHJ4 (MymaAcA), Q9F8V3 (CouY), P9WIP4 (MbtH), Q73XY9 (MypaAaA), A8CF84 (KtzJ), Q333U6 (TioT), Q0X0B7 (Ecm8), B1MAR0 (MyabAaA), and Q9I169 (PA2412). Supplementary Material Supporting Information Acknowledgements This work was supported by a NSF...”

SCO0489 hypothetical protein from Streptomyces coelicolor A3(2)
SLIV_35495 MbtH family protein from Streptomyces lividans TK24
48% identity, 89% coverage

• antiSMASH 7.0: new and improved predictions for detection, regulation, chemical structures and visualisation
  Blin, Nucleic acids research 2023
  • “...bases of the binding site. The DmdR1 hit is located between and upstream of both SCO0489 and SCO0490. ( C ) shows the first modules of the Streptomyces colinus T 365 hybrid trans-AT PKS/NRPS kirromycin gene cluster (MIBiG ID: BGC0001070). Transcription factor binding site predictions The...”
• The Inhibition of Antibiotic Production in Streptomyces coelicolor Over-Expressing the TetR Regulator SCO3201 IS Correlated With Changes in the Lipidome of the Strain
  Zhang, Frontiers in microbiology 2020
  • “...), germicidin ( sco7221 ), 2-methylisoborneol ( sco7700 - sco7701 ), the siderophores coelichelin ( sco0489 - sco0499 ), desferrioxamine ( sco2782 - sco2785 ), and putative siderophore encoded by sco5799 - sco5801 as well as the PKS encoding genes ( sco1265 - sco1273 ) and...”
• The Transcription Unit Architecture of Streptomyces lividans TK24
  Lee, Frontiers in microbiology 2019
  • “...< 0.05) ( Supplementary Figure 9A ). For coelichelin BGC, 3 genes of S. coelicolor (SCO0489, SCO0492 and SCO0498) were down-regulated during late-exponential phase, while their homologs of S. lividans (SLIV_35495, SLIV_35480 and SLIV_35450) were up-regulated. Similarly, SCO7221 of germicidin BGC was down-regulated during mid-exponential phase,...”
• Quantitative Proteome and Phosphoproteome Analyses of Streptomyces coelicolor Reveal Proteins and Phosphoproteins Modulating Differentiation and Secondary Metabolism
  Rioseras, Molecular & cellular proteomics : MCP 2018
  • “...1.6 6 3 SCO6282 3 2.7 - 6.5 - SCO6283 3 2.6 - 5,9 - SCO0489 Coelichelin biosynthesis 1 -1.5 2 0.3 SCO0492 3 1.1 n.s. 2.1 n.s. SCO0498 3 1.6 - 3 - SCO0499 3 1.2 n.s. 2.3 n.s. SCO5072 5 ACT biosynthesis n.s. 3.6...”
• Activation and products of the cryptic secondary metabolite biosynthetic gene clusters by rifampin resistance (rpoB) mutations in actinomycetes
  Tanaka, Journal of bacteriology 2013
  • “...S. coelicolor SCO0124 Hypothetical protein SCO0381 SCO0489 SCO1207 Putative glycosyl transferase Conserved hypothetical protein Putative cytochrome P450 SCO1268...”
• The global role of ppGpp synthesis in morphological differentiation and antibiotic production in Streptomyces coelicolor A3(2)
  Hesketh, Genome biology 2007
  • “...that, in addition to act , red and whiE mentioned above, clusters for coelichelin ( SCO0489 - 99 ) the hopanoids ( SCO6759 - 71 ), eicosapentaenoic acid ( SCO0124 - 29 ), CDA ( SCO3210 - 49 ), an unknown deoxysugar/glycosyltransferase product ( SCO0381 -...”
• Bioinformatic identification of novel regulatory DNA sequence motifs in Streptomyces coelicolor
  Studholme, BMC microbiology 2004
  • “...several related matrices (363, 571, 293 and 153). One match falls between the divergently transcribed SCO0489 and SCO0490, the second falls between the divergently transcribed SCO0498 and SCO0499, and the third falls upstream of SCO0495. It seems plausible that this motif may be involved in coordinated...”
• The Transcription Unit Architecture of Streptomyces lividans TK24
  Lee, Frontiers in microbiology 2019
  • “...(SCO0489, SCO0492 and SCO0498) were down-regulated during late-exponential phase, while their homologs of S. lividans (SLIV_35495, SLIV_35480 and SLIV_35450) were up-regulated. Similarly, SCO7221 of germicidin BGC was down-regulated during mid-exponential phase, while S. lividans homolog, SLIV_03190, was up-regulated. Meanwhile, the overall gene expression pattern of each...”

mbtH / P9WIP5 putative conserved protein from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 10 papers)
NP_216893, Rv2377c PUTATIVE CONSERVED PROTEIN MBTH from Mycobacterium tuberculosis H37Rv
45% identity, 92% coverage

• Comparison of the transcriptome, lipidome, and c-di-GMP production between BCGΔBCG1419c and BCG, with Mincle- and Myd88-dependent induction of proinflammatory cytokines in murine macrophages
  Flores-Valdez, Scientific reports 2024
  • “...EBG00001157315 EBG00001157315 5S_rRNA 1.05 0.031607557 BCG_2922c BCG_2922c Rv2901c Conserved hypothetical protein 1.0287 0.037531455 mbtH BCG_2391c Rv2377c Putative conserved protein mbtH 1.004 0.011346227 BCG_0026c BCG_0026c Rv3920c Hypothetical protein similar to jag protein 0.9649 0.02941768 phoY1_1 BCG_3330c Rv3301c Probable phosphate-transport system transcriptional regulatory protein phoU homolog 1 phoY1...”
• Applications of Transcriptomics and Proteomics for Understanding Dormancy and Resuscitation in Mycobacterium tuberculosis
  Kundu, Frontiers in microbiology 2021
  • “.... DosR-independent cluster consisting of Rv2028cpfkBRv2030cacracg , six genes of the mycobactin synthesis cluster ( Rv2377c to Rv2386c, mbtA-I ), bfrB ; Rv3182 , Rv3183 , Rv1964 , Rv1130 (likely to encode 2-methylcitrate hydratase prpD ) and accD2 (predicted acetyl/propionyl CoA carboxylase). Bacon et al., 2004...”
  • “...( bfrB ) ( Voskuil et al., 2004 ) and mycobactin synthesizing gene cluster ( Rv2377c to Rv2386c, mbtA-I ) were induced during hypoxia ( Bacon et al., 2004 ; Voskuil et al., 2004 ). Muttucumaru et al. (2004) confirmed the upregulation of the mycobactin biosynthesizing...”
• Heat-killed Mycolicibacterium aurum Aogashima: An environmental nonpathogenic actinobacteria under development as a safe novel food ingredient
  Nouioui, Food science & nutrition 2021
  • “...Rv2379c 55.6 <95% 0 Mbt G orf00503 Rv2378c 76.9 <95% .16 Mbt H orf00502; orf01576 Rv2377c 73.5 <95% 6E41 Mbt J orf04363 Rv2385 60.6 <95% 4E131 Mbt K orf05262 Rv1347c 62.7 <95% 4E88 Pantothenate synthesis Pan C orf05603 Rv3602c 70.5 <95% 6E138 PanD orf00584 Rv3601c 63.1...”
• Functional Cross-Talk of MbtH-Like Proteins During Thaxtomin Biosynthesis in the Potato Common Scab Pathogen Streptomyces scabiei
  Li, Frontiers in microbiology 2020
  • “...from the current study ( Figure 6C ). In addition, the solution structure of the Rv2377c MLP from M. tuberculosis and of PA2412 from P. aeruginosa has demonstrated that the highly conserved WTDxRP portion of the motif is within an intrinsically disordered region in both proteins...”
• Investigating function roles of hypothetical proteins encoded by the Mycobacterium tuberculosis H37Rv genome
  Yang, BMC genomics 2019
  • “...Transcriptional repressor RcnR 92.89 4 3 Rv0587 NP_215101.1 yciC Membrane protein YciC 91.12 3 4 Rv2377c NP_216893.1 ybdZ Enterobactin biosynthesis protein YbdZ 90.66 5 5 Rv1487 NP_216003.1 ybbJ Membrane protein YbbJ 90.10 6 6 Rv0025 NP_214539.1 yqjE Membrane protein YqjE 89.70 3 7 Rv1766 NP_216282.2 holE...”
• Solution NMR Studies of Mycobacterium tuberculosis Proteins for Antibiotic Target Discovery
  Kim, Molecules (Basel, Switzerland) 2017
  • “...72 ]. Two siderophore-related proteins have been studied by NMR in M . tuberculosis . Rv2377c, MbtH, is a small, 71-residue protein, and one of the proteins composing non-ribosomal protein synthetase clusters involved in siderophore and antibiotic peptide synthesis [ 73 ]. The structure of Rv2377c...”
  • “...(PDB ID 2L59); ( G ) Rv3198.1 (PDB ID 2LQQ). Siderophore-related proteins ( H ) Rv2377c (PDB ID 2KHR); ( I ) Rv0451c (PDB ID 2LW3). Secreted proteins ( J ) Rv2875 (PDB ID 1NYO); ( K ) Rv1980c (PDB ID 2HHI); ( L ) Rv3875/Mb3904...”
• Genome Analysis of the Fruiting Body-Forming Myxobacterium Chondromyces crocatus Reveals High Potential for Natural Product Biosynthesis
  Zaburannyi, Applied and environmental microbiology 2016
  • “...Mycobacterium tuberculosis H37Rv (GenBank accession number NP_216893) and the phosphopantetheinyl transferase from Sorangium cellulosum So ce56 (GenBank...”
• The Complete Genome Sequence of the Emerging Pathogen Mycobacterium haemophilum Explains Its Unique Culture Requirements
  Tufariello, mBio 2015
  • “...mbtA-mbtJ locus in H37Rv, does appear to be present [with 78% identity to H37Rv MbtH (Rv2377c) over 71amino acids]. However, the product of this gene may not function in mycobactin synthesis, as homologues in other bacteria, such as actinomycetes and a rapid-growing mycobacterium, Mycobacterium smegmatis ,...”
• More

SCAB_85461 hypothetical protein from Streptomyces scabiei 87.22
44% identity, 91% coverage

• TxtH is a key component of the thaxtomin biosynthetic machinery in the potato common scab pathogen Streptomyces scabies
  Li, Molecular plant pathology 2019
  • “...in the S. scabies 87.22 genome, SCAB_3331 (herein referred to as MLP lipo ) and SCAB_85461 (herein referred to as MLP scab ), both share only 52.3% amino acid identity with TxtH (Table S1 ) and cluster together in a separate clade as compared to the...”

B1MAR0 MbtH family protein from Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
48% identity, 88% coverage

• Using MbtH-Like Proteins to Alter the Substrate Profile of a Nonribosomal Peptide Adenylation Enzyme.
  Mori, Chembiochem : a European journal of chemical biology 2018
  • “...(MysmAbA), B2HHJ4 (MymaAcA), Q9F8V3 (CouY), P9WIP4 (MbtH), Q73XY9 (MypaAaA), A8CF84 (KtzJ), Q333U6 (TioT), Q0X0B7 (Ecm8), B1MAR0 (MyabAaA), and Q9I169 (PA2412). Supplementary Material Supporting Information Acknowledgements This work was supported by a NSF CAREER Award MCB-1149427 (to S.G.-T.), the Department of Pharmaceutical Sciences (to S.G.-T.) and the...”

BASU_2822 MbtH family protein from Bacillus velezensis UCMB5113
51% identity, 87% coverage

• Genetic, Epigenetic and Phenotypic Diversity of Four Bacillus velezensis Strains Used for Plant Protection or as Probiotics
  Reva, Frontiers in microbiology 2019
  • “...2523505-2524858 188 2.56 nrpsB 2524862-2525852 76 1.48 nrpsA 2525907-2526975 153 1.37 Bacillibactin 3014162-3027137 3089364-3102339 3089337-3102312 BASU_2822 ybdZ 3014162-3014378 1 5.4 3089364-3089580 76 1.00 3089337-3089553 4 1.55 BASU_2823 dhbF 3014396-3021524 19 3.51 3089598-3096726 1262 1.03 3089571-3096699 36 3.10 BASU_2824 dhbB 3021538-3022465 3 1.51 3096740-3097667 222 1.15 3096713-3097640...”

MAB_4100c MbtH-like protein from Mycobacterium abscessus ATCC 19977
46% identity, 89% coverage

• Global prevalence of <i>Mycobacterium massiliense</i> strains with recombinant <i>rpoB</i> genes (Rec-Mas) horizontally transferred from <i>Mycobacterium abscessus</i>: two major types, dominant circulating clone 7 and MLST ST46 sequence type
  Kim, Microbiology spectrum 2024
  • “...100.0% 100.0% 100.0% 96.2% mps1 MAB_4099c Nonribosomal peptide synthetase CDS 85.9% 100.0% 87.8% 100.0% mbtH MAB_4100c MbtH family protein CDS 99.6% 100.0% 100.0% 100.0% fmt MAB_4103c Class I SAM-dependent methyltransferase CDS 87.8% 100.0% 100.0% 100.0% gtf2 MAB_4104 Glycosyltransferase CDS 100.0% 100.0% 100.0% 100.0% rmt3 MAB_4105c TylF/MycF/NovP-related...”
• A Simplified and Efficient Method for Himar-1 Transposon Sequencing in Bacteria, Demonstrated by Creation and Analysis of a Saturated Transposon-Mutant Library in Mycobacterium abscessus
  Foreman, mSystems 2020
  • “...AACAGGGACTGC TA TTCCAGGCCGGA MAB_4099c 10,365 4,582 GTTGGAGAGTTG TA TGTGGCCGGCTC MAB_4099c 10,365 6,936 GCCTGCCTGGAG TA CATCGAACAAAA MAB_4100c 231 150 GCCGAGCTGCAC TA CCTGTTCGAGAA MAB_4163c 1,647 279 ACGAGGGGTACG TA CAGGTCGCCGAG MAB_4207 1,350 316 + AACATCCTCTAC TA CATGGTGGTCAC MAB_4485 1,347 795 + GAATCCCGTTGC TA TGTACCTGGTTC MAB_4,554c 1,485 680 CTGCTGCGGTTG TA...”
• Mabellini: a genome-wide database for understanding the structural proteome and evaluating prospective antimicrobial targets of the emerging pathogen Mycobacterium abscessus
  Skwark, Database : the journal of biological databases and curation 2019
  • “...22 ) MAB_2875 289 245 84.8 99.6 0.504 0.71 2.258 -Lactam Resistance ( 22 ) MAB_4100c 76 75 98.7 82.7 0.451 0.415 2.809 GPL Biosynthetic Pathway ( 64 ) MAB_4103c 267 225 84.3 20.2 0.6 0.381 4.024 MAB_4105c 262 236 90.1 23 0.433 0.758 3.587 MAB_4108c...”
  • “...the 21 genes present in this locus (two of which are putative proteins): MbtH-like protein (MAB_4100c), Fmt (MAB_4103c), Rmt3 (MAB_4105c), Rmt4 (MAB_4108c), Rmt2 (MAB_4109c), RmlB (MAB_4111c), Gtf3 (MAB_4112c), RmlA (MAB_4113), MmpL4b (MAB_4115c), MmpL4a (MAB_4116c) and MMpS4 (MAB_4117c) with coverages for the best models in each case...”
• Subinhibitory Doses of Aminoglycoside Antibiotics Induce Changes in the Phenotype of Mycobacterium abscessus
  Tsai, Antimicrobial agents and chemotherapy 2015
  • “...MAB_0937c MAB_0938c MAB_0939 MAB_4098c MAB_4099c MAB_4100c MAB_4103c MAB_4104 MAB_4105c MAB_4110c MAB_4111c MAB_4112c MAB_4113 MAB_4114 MAB_4115c MAB_4116c...”
• Rough colony morphology of Mycobacterium massiliense Type II genotype is due to the deletion of glycopeptidolipid locus within its genome
  Kim, BMC genomics 2013
  • “...MC1631c 81 MSMEG0385 67 fmt MAB_4103c Probable methyltransferase MMAS_40450 99 MC1632 85 MSMEG0386 68 mbtH MAB_4100c MbtH-like protein MMAS_40430 99 MASS_4722 86 MC1635 100 MSMEG0387 91 mps1 MAB_4099c Probable non-ribosomal peptide synthetase MMAS_40410 99 MC1636 86 MSMEG0390 70 mps2 MAB_4098c Probable peptide synthetase NRP MMAS_40400 99...”

ACM01_RS10820 thaxtomin biosynthesis NRPS accessory protein TxtH from Streptomyces viridochromogenes
46% identity, 87% coverage

• TxtH is a key component of the thaxtomin biosynthetic machinery in the potato common scab pathogen Streptomyces scabies
  Li, Molecular plant pathology 2019
  • “...formed a wellsupported clade in the constructed phylogenetic tree (Fig. 2 B). Interestingly, an MLP (ACM01_RS10820) from the nonpathogenic species Streptomyces viridochromogenes also clustered together with the TxtH homologues from the pathogenic species and showed a very high degree of amino acid identity (97%) with TxtH...”

CGL27_RS10110 MbtH family protein from Streptomyces sp. 11-1-2
55% identity, 71% coverage

• Functional Cross-Talk of MbtH-Like Proteins During Thaxtomin Biosynthesis in the Potato Common Scab Pathogen Streptomyces scabiei
  Li, Frontiers in microbiology 2020
  • “...n/a Kieser et al., 2000 Streptomyces sp. 11-1-2 Source of genomic DNA for amplifying the CGL27_RS10110 and CGL27_RS02360 coding sequences n/a Bown and Bignell, 2017 Streptomyces europaeiscabiei 89-04 Source of genomic DNA for amplifying the AWZ11_RS05060 coding sequence n/a Zhang et al., 2016 Streptomyces clavuligerus ATCC27064...”
  • “...for expression of the HIS 6 -YbdZ protein Kan R This study pET28b/HIS 6 - CGL27_RS10110 pET28b derivative containing a DNA fragment for expression of the HIS 6 -CGL27_RS10110 protein Kan R This study pET28b/HIS 6 - CGL27_RS02360 pET28b derivative containing a DNA fragment for expression...”

CGL27_RS02360 MbtH family protein from Streptomyces sp. 11-1-2
44% identity, 96% coverage

• Functional Cross-Talk of MbtH-Like Proteins During Thaxtomin Biosynthesis in the Potato Common Scab Pathogen Streptomyces scabiei
  Li, Frontiers in microbiology 2020
  • “...et al., 2000 Streptomyces sp. 11-1-2 Source of genomic DNA for amplifying the CGL27_RS10110 and CGL27_RS02360 coding sequences n/a Bown and Bignell, 2017 Streptomyces europaeiscabiei 89-04 Source of genomic DNA for amplifying the AWZ11_RS05060 coding sequence n/a Zhang et al., 2016 Streptomyces clavuligerus ATCC27064 Wild-type strain...”
  • “...for expression of the HIS 6 -CGL27_RS10110 protein Kan R This study pET28b/HIS 6 - CGL27_RS02360 pET28b derivative containing a DNA fragment for expression of the HIS 6 -CGL27_RS02360 protein Kan R This study pET28b/HIS 6 - AWZ11_RS05060 pET28b derivative containing a DNA fragment for expression...”

SACE_2692 MbtH-like protein from Saccharopolyspora erythraea NRRL 2338
46% identity, 87% coverage

• Complete gene expression profiling of Saccharopolyspora erythraea using GeneChip DNA microarrays
  Peano, Microbial cell factories 2007
  • “...specify the synthesis of a pentameric siderophore, possibly starting with a 2,3-dihydroxybenzoate unit, for which SACE_2692 through SACE_2696 would be required. The other three co-expressed genes from the nrps3 cluster are expected to encode a putative ABC-type Fe 3+ -siderophores transport system (SACE_2697), a putative regulatory...”

MAH_2060, MAP4_2610, OCQ_31530 MbtH family protein from Mycobacterium avium subsp. paratuberculosis MAP4
49% identity, 83% coverage

• Comparative genomics between human and animal associated subspecies of the Mycobacterium avium complex: a basis for pathogenicity
  Timms, BMC genomics 2015
  • “...strain (S5) originally isolated from a goat, MAP4_2610 from M. paratuberculosis MAP4 (a human isolate), MAH_2060 of M. avium TH135 and gene OCQ_31530 in M. intracellulare (strain MOTT-64). In addition to differences in the size of genes within the mycobactin gene cluster, there were also differences...”
  • “...including the D522_08303 gene in another M. paratuberculosis strain (S5) originally isolated from a goat, MAP4_2610 from M. paratuberculosis MAP4 (a human isolate), MAH_2060 of M. avium TH135 and gene OCQ_31530 in M. intracellulare (strain MOTT-64). In addition to differences in the size of genes within...”
  • “...MAP4_2610 from M. paratuberculosis MAP4 (a human isolate), MAH_2060 of M. avium TH135 and gene OCQ_31530 in M. intracellulare (strain MOTT-64). In addition to differences in the size of genes within the mycobactin gene cluster, there were also differences in the spacing between the genes and...”

RSp0640 MbtH family protein from Ralstonia pseudosolanacearum GMI1000
51% identity, 73% coverage

• Modulation of Inter-kingdom Communication by PhcBSR Quorum Sensing System in Ralstonia solanacearum Phylotype I Strain GMI1000
  Li, Frontiers in microbiology 2017
  • “...of ralsolamycin biosynthesis and transport, including rmyA , rmyB , RSp0638 , RSp0639 , and RSp0640 ( Spraker et al., 2016 ). Although the later three genes are not in the same operon as rmyA and rmyB , their protein characteristics, and the similar QS-dependent expression...”
• Ralstonia solanacearum lipopeptide induces chlamydospore development in fungi and facilitates bacterial entry into fungal tissues
  Spraker, The ISME journal 2016
  • “...its biosynthesis and transport including rmyA , rmyB and three additional genes: RSp0638, RSp0639 and RSp0640 ( Figure 4a ) encoding a transmembrane cyclic peptide transporter, a metallo-beta-lactamase and an MbtH-like protein, respectively ( Figure 5b , Supplementary Table S6 ). Comparative analysis of the available...”

BV309_02880 MbtH family protein from Streptomyces clavuligerus
49% identity, 83% coverage

• Teleocidin-producing genotype of Streptomyces clavuligerus ATCC 27064
  Pivk, Applied microbiology and biotechnology 2022
  • “...and 66%, respectively. The tleA and tleB genes are interspaced with a putative MbtH-encoding gene (BV309_02880). Interestingly, in analogy with the S . blastmyceticus , a methyltransferase gene tleD , which is needed for conversion of teleocidin A to teleocidin B (Abe 2018 ), is not...”

MAP1872c MbtH_2 from Mycobacterium avium subsp. paratuberculosis str. k10
MAH_2755 MbtH family protein from Mycobacterium avium subsp. hominissuis TH135
41% identity, 95% coverage

• Vaccine approaches for the 'therapeutic management' of Mycobacterium avium subspecies paratuberculosis infection in domestic livestock
  Gupta, The veterinary quarterly 2019
  • “...al. 2014 New York, USA leuD Strain 66115-98 Faisal et al. 2013 University of Wisconsin MAP1872c ( mbtH_2 ) ATCC19698 Kabara and Coussens, 2012 AgResearch NZ MAP1566 strain 989 Scandurra et al. 2010 AgResearch NZ MAP0011 ( ppiA ) K-10 Scandurra et al. 2010 Washington State...”
• A rational framework for evaluating the next generation of vaccines against Mycobacterium avium subspecies paratuberculosis
  Bannantine, Frontiers in cellular and infection microbiology 2014
  • “...et al., 2006 University of Wisconsin 330 MAP1719c ATCC19698 No No University of Wisconsin 331 MAP1872c ( mbtH_2 ) ATCC19698 No No Kabara and Coussens, 2012 University of Wisconsin 332 MAP4288 ( lpqP ) ATCC19698 No No a The location of the laboratory where the mutant(s)...”
  • “...indicating that lsr2 is not involved in this process. However, a Tn 5367 insertion in MAP1872c was not able to prevent apoptosis, indicating that this gene may be involved in regulating this host cell process. The gene encodes an iron acquisition protein (Zhu et al., 2008...”
• Infection of Primary Bovine Macrophages with Mycobacterium avium Subspecies paratuberculosis Suppresses Host Cell Apoptosis
  Kabara, Frontiers in microbiology 2012
  • “...each of these MAP strains is shown in Table 2 . Our data indicates that MAP1872c mutated in strain 222 is likely important for MAP infection driven regulation of host cell death. Figure 6 Macrophages infected with MAP mutants fail to prevent host cell apoptosis ....”
  • “...219 Transposon mutagenesis (Tn 5367) MAP2408c 221 Homologous recombination MAP1719c 222 Transposon mutagenesis (Tn 5367) MAP1872c Several different mutant MAP strains were used in our study. For each mutant MAP strain used in our study, the nature of the mutation as well as the gene involved...”
• Defining the stressome of Mycobacterium avium subsp. paratuberculosis in vitro and in naturally infected cows
  Wu, Journal of bacteriology 2007
  • “...Berkeley MAP0834c, prrA MAP1228, lipL MAP3006c, lipN MAP1643, aceAB MAP1872c, mbtH2 MAP4288, lpqP Fold change 7884 WU ET AL. J. BACTERIOL. among isolates of M....”
• Characterization of a novel plasmid, pMAH135, from Mycobacterium avium subsp. hominissuis
  Uchiya, PloS one 2015
  • “...avium TH135 pMAH135 Locus tag Locus tag Locus tag Mycobactin mbtH Rv2377c MAH_1634 (70.6%) a MAH_2755 (78.3%) mbtG Rv2378c MAH_1633 (88.7%) mbtF Rv2379c MAH_1632 (60.0%) MAH_p48 (41.7% b /43.6% c ) mbtE Rv2380c MAH_1631 (65.3%) MAH_p47 (44.9%/44.0%) mbtD Rv2381c MAH_1630 (46.9%) MAH_p43 (34.9%/35.3%) mbtC Rv2382c MAH_1629...”

BPSL1726 conserved hypothetical protein from Burkholderia pseudomallei K96243
42% identity, 89% coverage

• Molecular basis of rare aminoglycoside susceptibility and pathogenesis of Burkholderia pseudomallei clinical isolates from Thailand
  Trunck, PLoS neglected tropical diseases 2009
  • “...synthase BPSL1722 Putative formyl transferase BPSL1723 Hypothetical protein BPSL1724 Putative histidinol-phosphate aminotransferase BPSL1725 Hypothetical protein BPSL1726 Hypothetical protein BPSL1727 Putative non-ribosomal peptide synthase (thioesterase domain) BPSL1727 Putative non-ribosomal peptide synthase (thioesterase domain) BPSL1728 Putative exported porin BPSL1729 Putative AraC-family transcriptional regulator BPSL1730 Putative transmembrane protein BPSL1731...”

Q73XY9 MbtH_3 from Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
MAH_1634, MAH_RS08065, MAP_RS11035 MbtH family protein from Mycobacterium avium subsp. hominissuis TH135
41% identity, 84% coverage

• Using MbtH-Like Proteins to Alter the Substrate Profile of a Nonribosomal Peptide Adenylation Enzyme.
  Mori, Chembiochem : a European journal of chemical biology 2018
  • “...MLPs studied were A0QF81 (MyavAaA), A0QHN9 (MyavAcA), Q3L893 (MysmAbA), B2HHJ4 (MymaAcA), Q9F8V3 (CouY), P9WIP4 (MbtH), Q73XY9 (MypaAaA), A8CF84 (KtzJ), Q333U6 (TioT), Q0X0B7 (Ecm8), B1MAR0 (MyabAaA), and Q9I169 (PA2412). Supplementary Material Supporting Information Acknowledgements This work was supported by a NSF CAREER Award MCB-1149427 (to S.G.-T.), the...”
• Delineating transcriptional crosstalk between Mycobacterium avium subsp. paratuberculosis and human THP-1 cells at the early stage of infection via dual RNA-seq analysis
  Park, Veterinary research 2022
  • “...iron deficiency in MAP cells (Figure 4 C). Specifically, the gene sets mbtA to mbtH (MAP_RS11035 to MAP_RS11075) corresponding to mbt-1 and fadE14 (MAP_RS07905) and fadD33 (MAP_RS07910) corresponding to mbt-2 were upregulated. In addition, VFDB annotation included several putative acyl-CoA dehydrogenases classified as Iron uptake based...”
• Comparative genome analyses of Mycobacterium avium reveal genomic features of its subspecies and strains that cause progression of pulmonary disease
  Uchiya, Scientific reports 2017
  • “...HSR1 17334531734739 1,287 1,287 100% 12% MAH_RS08060 lysine 6-monooxygenase HSR1 17347201734935 216 216 100% 13% MAH_RS08065 protein mbtH HSR1 17351111735647 537 537 100% 12% MAH_RS08070 hypothetical protein HSR1 17359411736456 516 516 100% 12% MAH_RS08075 low molecular weight antigen MTB12 HSR1 17364501737340 891 656 74% 15% MAH_RS08080...”
• Characterization of a novel plasmid, pMAH135, from Mycobacterium avium subsp. hominissuis
  Uchiya, PloS one 2015
  • “...H37Rv M . avium TH135 pMAH135 Locus tag Locus tag Locus tag Mycobactin mbtH Rv2377c MAH_1634 (70.6%) a MAH_2755 (78.3%) mbtG Rv2378c MAH_1633 (88.7%) mbtF Rv2379c MAH_1632 (60.0%) MAH_p48 (41.7% b /43.6% c ) mbtE Rv2380c MAH_1631 (65.3%) MAH_p47 (44.9%/44.0%) mbtD Rv2381c MAH_1630 (46.9%) MAH_p43 (34.9%/35.3%)...”

CP977_04015 MbtH family protein from Streptomyces cinereoruber
43% identity, 87% coverage

• Iron competition triggers antibiotic biosynthesis in Streptomyces coelicolor during coculture with Myxococcus xanthus
  Lee, The ISME journal 2020
  • “...ATG CP984_01965 TaAGGTTAGcCTaACCTAA (124 nt) ATG Scabichelin 11 S. cinereoruber CP977_03980 TTAGGTTAGGCTaAgCTAA (83 nt) ATG CP977_04015 TTAGGTaAGcCTtACCTAA (101 nt) ATG CP977_04025 TTAGGTaAGcCTtACCTAA (40 nt) ATG Sequences in lower case indicate nonconserved nucleotides compared with the known DmdR1-binding site in the desferrioxamine BGC of S. coelicolor ....”

B7HR49 MbtH-like protein from Bacillus cereus (strain AH187)
40% identity, 83% coverage

• Bacillus cereus Decreases NHE and CLO Exotoxin Synthesis to Maintain Appropriate Proteome Dynamics During Growth at Low Temperature
  Duport, Toxins 2020
  • “...B7HK67 Conserved domain protein Cytoplasm 4.5 4.8 4.5 B7HTP5 Uncharacterized protein Cytoplasm 1.9 5.3 6.7 B7HR49 MbtH-like protein Cytoplasm 3.2 4.3 6.9 B7HT63 Uncharacterized protein Membrane 3.3 0.1 8.3 General function only B7HK99 Flavodoxin Cytoplasm 1.5 2.6 4.1 B7HWD7 Ferrous iron transport protein A Cytoplasm 0.6...”

BSU31959 hypothetical protein from Bacillus subtilis subsp. subtilis str. 168
44% identity, 85% coverage

• Characterization of the Functional Variance in MbtH-like Protein Interactions with a Nonribosomal Peptide Synthetase
  Schomer, Biochemistry 2017
  • “...inserts are listed in Supplementary Table 2 . Genes coding for MbtH, PA2412, Atu3678, MXAN_3118, BSU31959, CmnN, and VioN were cloned into pBAD33 with the ribosome binding site of pET37B. 1 These constructs control the expression of these genes by an arabinose-inducible promotor. 21 These genes...”
  • “...virus (TEV) cleavage site in between the peptide and an N-terminal H6-tag. 22 PA2412, Atu3878, BSU31959, and MXAN_3118 were cloned into pACYC-duet-1 for overexpression of an untagged protein. Additional plasmids are referenced in Table S3 . We note that a recent reconstruction of the Myxococcus xanthus...”

BPSS1267 putative MbtH-like protein from Burkholderia pseudomallei K96243
46% identity, 88% coverage

• BPSL1626: Reverse and Structural Vaccinology Reveal a Novel Candidate for Vaccine Design against Burkholderia pseudomallei
  Capelli, Antibodies (Basel, Switzerland) 2018
  • “...the initial set of eight B. pseudomallei proteomes. Remarkably, only four (BPSS2213, BPSS1498, BPSL1626, and BPSS1267) of the 104 proteins were fully conserved in the strains analyzed. The sequence variability of these four proteins with 349 B. pseudomallei strains is indicated in Figure S1 . We...”
  • “...and applied to the dimer structure of BPSL1626; Figure S1: Variability profile of BPSS2213, BPSS1498, BPSS1267 and BPSL1626 generated from multiple protein sequence alignments using 349 B. pseudomallei strains; Figure S2: Raw epitope prediction data made with structure- and sequence-based predictors. Click here for additional data...”

SCO3218 small conserved hypothetical protein from Streptomyces coelicolor A3(2)
Q7BRC2 Cda-orfX from Streptomyces coelicolor
43% identity, 89% coverage

• Cytosolic copper is a major modulator of germination, development and secondary metabolism in Streptomyces coelicolor
  González-Quiñónez, Scientific reports 2019
  • “...1.9 SCO1867 5-Hydroxyectoine biosynthesis 0.4 1.3 1.3 0.4 SCO2782 Desferrioxamine biosynthesis 0.6 1.4 0.7 2.7 SCO3218 CDA biosynthesis 1.8 1 3.6 0.5 SCO3221 CDA biosynthesis 1.4 1.2 2.7 2.3 SCO5223 Albaflavenone biosynthesis 0.5 0.6 0.7 1.5 SCO5799 Siderophore biosynthesis 0.9 1 0.6 0.5 SCO6766 Hopene biosynthesis...”
• Deciphering the regulon of Streptomyces coelicolor AbrC3, a positive response regulator of antibiotic production
  Rico, Applied and environmental microbiology 2014
  • “...gene SCO1550 SCO1839 SCO2113/bfr SCO2779/acdH SCO3218 SCO3327 SCO3328/bdtA SCO4425/afsS SCO5240/wblE SCO5915 SCO6205 SCO6992/absR1 Hydroxylacyl-CoA...”
  • “...in S. coelicolor and S. avermitilis (42), and SCO3218, a gene of unknown function located in the cda gene cluster, were also significantly downregulated...”
• Bacterial MbtH-like Proteins Stimulate Nonribosomal Peptide Synthetase-Derived Secondary Metabolism in Filamentous Fungi
  Zwahlen, ACS synthetic biology 2019
  • “...gene cluster GenBank ID reference ComB Q93N85 Streptomyces lavendulae Complestatine AF386507 ( 61 ) CdaI Q7BRC2 Streptomyces coelicolor Calcium dependent antibiotic AL939115 ( 62 ) Tcp13 Q70AZ5 Actinoplanes teichomyceticus Teicoplanin AJ605139 ( 63 ) Veg8 B7T1C1 uncultured soil bacterium putative (vancomycin-like eDNA derived gene cluster, VEG...”

BCE2403 mbtH-like protein from Bacillus cereus ATCC 10987
40% identity, 83% coverage

• Comparative Genomics of Iron-Transporting Systems in Bacillus cereus Strains and Impact of Iron Sources on Growth and Biofilm Formation
  Hayrapetyan, Frontiers in microbiology 2016
  • “...dhbE 3,3-dihydroxybenzoate-AMP ligase BC2305 BCE2401 dhbB Isochorismatase BC2306 BCE2402 dhbF Non-ribosomal surfactin synthetase SrfAA BC2309 BCE2403 mbtH Hypothetical protein BC2310 BCE2404 Drug resistance transporter, EmrB/QacA family BC2311 BCE2405 sfp Putative 3-phosphopantetheinyl transferase BC2312 BCE2406 Hypothetical protein BC3734 BCE3767 yuiI Trilactone hydrolase BC3735 BCE3768 feuD/yusV Siderophores ABC-transporter,...”

ACSP50_3047 MbtH family protein from Actinoplanes sp. SE50/110
40% identity, 84% coverage

• Sigma Factor Engineering in Actinoplanes sp. SE50/110: Expression of the Alternative Sigma Factor Gene ACSP50_0507 (σHAs) Enhances Acarbose Yield and Alters Cell Morphology
  Schlüter, Microorganisms 2024
  • “...1.67 10 23 142 ACSP50_3043 1,2 Glycosyltransferase family 2 protein 5.52 9.44 10 21 166 ACSP50_3047 2 MbtH-like protein 5.26 6.89 10 34 166 ACSP50_3058 2 Gfo/Idh/MocA family oxidoreductase 4.63 1.66 10 40 96 ACSP50_3379 Putative secreted protein 4.29 3.26 10 13 142 ACSP50_3380 Membrane protein...”

GBAA2373 mbtH-like protein from Bacillus anthracis str. 'Ames Ancestor'
40% identity, 83% coverage

• Transcriptional profiling of Bacillus anthracis Sterne (34F2) during iron starvation
  Carlson, PloS one 2009
  • “...18.0 46.7 isochorismatase GBAA1395 17.8 44.9 hypothetical protein GBAA1395 GBAA2376 17.7 44.0 hypothetical protein GBAA2376 GBAA2373 17.4 41.3 mbtH-like protein GBAA2372 16.7 35.5 nonribosomal peptide synthetase DhbF GBAA2375 16.2 32.1 4-phosphopantetheinyl transferase, putative GBAA4597 16.1 30.9 iron compound ABC transporter, iron compound-binding protein GBAA1346 15.9 29.9...”
• The global transcriptional responses of Bacillus anthracis Sterne (34F2) and a Delta sodA1 mutant to paraquat reveal metal ion homeostasis imbalances during endogenous superoxide stress
  Passalacqua, Journal of bacteriology 2007
  • “...to -2372), but in B. anthracis, three downstream genes (GBAA2373, -2374, and -2375) that are not present in the B. subtilis dhb region are also overexpressed...”

Q7N7D2 L-alanine-L-anticapsin ligase (EC 6.3.2.49) from Photorhabdus laumondii subsp. laumondii (see paper)
54% identity, 10% coverage

MSMEG_0016 hypothetical protein from Mycobacterium smegmatis str. MC2 155
39% identity, 83% coverage

• Production of mycobacterial cell wall glycopeptidolipids requires a member of the MbtH-like protein family
  Tatham, BMC microbiology 2012
  • “...the mycobactin biosynthetic gene cluster of Ms mentioned above [ 35 ]. The second gene, MSMEG_0016, is clustered with genes implicated in the production of the siderophore exochelin [ 48 - 50 ]. The protein products of these two Ms gplH paralogues have considerable amino acid...”
  • “...a meaningful level under our culturing conditions. It is worth noting that Ms mbtH and MSMEG_0016 are associated with siderophore production pathways known to be repressed during growth under iron-rich conditions [ 51 , 52 ]. This fact raises the possibility that neither of these genes...”
• Mutational and phylogenetic analyses of the mycobacterial mbt gene cluster
  Chavadi, Journal of bacteriology 2011
  • “...found for M. tuberculosis (36). One of these proteins, MSMEG_0016 (64% amino acid sequence identity with M. smegmatis MbtH), is encoded by a gene clustered with...”
  • “...(1, 19, 38). Based on the genetic context, MSMEG_0016 and MSMEG_0399 are likely to be involved in exochelin MS and glycopeptidolipid production, respectively....”

BC2309 Antibiotic/siderophore biosynthesis protein from Bacillus cereus ATCC 14579
39% identity, 83% coverage

• Comparative Genomics of Iron-Transporting Systems in Bacillus cereus Strains and Impact of Iron Sources on Growth and Biofilm Formation
  Hayrapetyan, Frontiers in microbiology 2016
  • “...BCE2400 dhbE 3,3-dihydroxybenzoate-AMP ligase BC2305 BCE2401 dhbB Isochorismatase BC2306 BCE2402 dhbF Non-ribosomal surfactin synthetase SrfAA BC2309 BCE2403 mbtH Hypothetical protein BC2310 BCE2404 Drug resistance transporter, EmrB/QacA family BC2311 BCE2405 sfp Putative 3-phosphopantetheinyl transferase BC2312 BCE2406 Hypothetical protein BC3734 BCE3767 yuiI Trilactone hydrolase BC3735 BCE3768 feuD/yusV Siderophores...”

JQN84_14135 AMP-binding protein from Micromonospora humidisoli
52% identity, 4% coverage

• Taxonomic Positions and Secondary Metabolite-Biosynthetic Gene Clusters of Akazaoxime- and Levantilide-Producers
  Komaki, Life (Basel, Switzerland) 2023
  • “...M. humidisoli MMS20-R2-29 T M. humidisoli MMS20-R2-29 T M. humidisoli MMS20-R2-29 T nrps-2 7_47680 99/99 JQN84_14135 M. humidisoli MMS20-R2-29 T nrps-3 7_56920 7_56930 7_56940 7_56970 99/100 99/99 99/99 99/99 JQN84_29450 JQN84_29445 JQN84_29440 JQN84_29425 M. humidisoli MMS20-R2-29 T M. humidisoli MMS20-R2-29 T M. humidisoli MMS20-R2-29 T M....”

ltxB / Q5V8A7 (-)-indolactam synthase from Lyngbya majuscula (see 4 papers)
44% identity, 14% coverage

MEG1_RS04960 phototemtide A NRPS accessory protein PttA from Photorhabdus temperata subsp. temperata Meg1
38% identity, 85% coverage

• Phototemtide A, a Cyclic Lipopeptide Heterologously Expressed from Photorhabdus temperata Meg1, Shows Selective Antiprotozoal Activity
  Zhao, Chembiochem : a European journal of chemical biology 2020
  • “...applied to activate pttBC in wellcharacterized E.coli . Notably, one MbtHencoding gene, termed pttA ( MEG1_RS04960 , 195bp) is located 0.8kb upstream from pttB . The MbtH proteins have been proposed to play an important role in stimulating adenylation reactions that are required for biosynthesis of...”

XIS1_1050018 MbtH family NRPS accessory protein from Xenorhabdus innexi
40% identity, 76% coverage

• The insect pathogenic bacterium Xenorhabdus innexi has attenuated virulence in multiple insect model hosts yet encodes a potent mosquitocidal toxin
  Kim, BMC genomics 2017
  • “...1 A domain XIS1_660020 - XIS1_660029 21,609 Hybrid 3 A domains and 1 AT domain XIS1_1050018 - XIS1_1050019 3366 NRPS 1 A domain XIS1_1690009 - XIS1_1690010 23,319 NRPS 7 A domains XIS1_1700078 11,811 NRPS 3 A domains XIS1_1750018 - XIS1_1750021 44,826 NRPS 13 A domains a...”

jk1783 hypothetical protein from Corynebacterium jeikeium K411
34% identity, 79% coverage

• The DtxR protein acting as dual transcriptional regulator directs a global regulatory network involved in iron metabolism of Corynebacterium glutamicum
  Brune, BMC genomics 2006
  • “...- JK1778 TTAGCTTAGGTTTACCTAT - enterochelin esterase - JK1780 ATAGGTTAGCCTACCCTTT - L-ornithine N 5 -oxygenase - JK1783 TTAGGTTATGCTAAGTTAA JK1782-1781 ABC transporter - JK1805 TTAGGCAAGGGTAAGCTAA - iron utilization protein - JK1809 ACAGGTTAGGCTAACCAGA JK1808-1806 ABC transport system - JK1812 TTAGGTAAGGCTACCATCA - solute binding protein - JK1815 CAAGTGAAGGCTTACCTTA JK18161818 iron...”
• Complete genome sequence and analysis of the multiresistant nosocomial pathogen Corynebacterium jeikeium K411, a lipid-requiring bacterium of the human skin flora
  Tauch, Journal of bacteriology 2005
  • “...K411 are part of two gene clusters (jk1772 to jk1783 and jk1805 to jk1821) apparently involved in siderophore synthesis and iron acquisition. Analysis of the...”
  • “...DNA regions revealed that cluster I (jk1772 to jk1783) is an integral part of the 33.6-kb transposable element Tn3596 (Table 2) This composite transposon...”

TERTU_4066 MbtH-like protein from Teredinibacter turnerae T7901
37% identity, 61% coverage

• Turnerbactin, a novel triscatecholate siderophore from the shipworm endosymbiont Teredinibacter turnerae T7901
  Han, PloS one 2013
  • “...transporter ABC30520 Hahella chejuensis KCTC 2396 76/60 TERTU_4065 445 Esterase ACS85292 Dickeya dadantii Ech703 50/38 TERTU_4066 85 MbtH domain protein ACZ77654 Dickeya dadantii Ech586 73/56 tnbF 2399 NRPS AAN28936 Acinetobacter baumannii 62/45 TERTU_4068 417 Enterobactin exporter ZP_10160264 Vibrio campbellii DS40M4 73/52 The gene tnbF codes for...”
  • “...also found in this cluster that are likely to assist in siderophore transport and uptake. TERTU_4066 codes for an MbtH-like protein [43] , a protein of unknown function that is found in many but not all NRPS gene clusters. TERTU_4068 codes for a putative homologue of...”

slgN1 / CBA11570.1 non-ribosomal peptide synthetase from Streptomyces lydicus (see paper)
37% identity, 11% coverage

4gr5C / D1GLU5 Crystal structure of slgn1deltaasub in complex with ampcpp (see paper)
38% identity, 12% coverage

• Ligand: diphosphomethylphosphonic acid adenosyl ester (4gr5C)

Z0726 No description from Escherichia coli O157:H7 EDL933
29% identity, 93% coverage

• Comparison of strand-specific transcriptomes of enterohemorrhagic Escherichia coli O157:H7 EDL933 (EHEC) under eleven different environmental conditions including radish sprouts and cattle feces
  Landstorfer, BMC genomics 2014
  • “...(0) 1.6 (7) 2.1 (3) 3.5 (0) 5.2 (60) 3.5 (0) 2.4 (8) 2.3 (2) Z0726 hypothetical protein minimal medium 1 (3) 2.0 (8) 2.6 (0) 2.2 (14) 3.6 (41) 2.6 (0) 1.6 (3) 7.5 (400) 2.6 (0) 2.6 (0) 4.8 (17) Z1519 hypothetical protein minimal...”
• Epigenetic inheritance based evolution of antibiotic resistance in bacteria
  Adam, BMC evolutionary biology 2008
  • “...pump) ATGCTTCAATAATATTGAAAAAGGAAGAGTGTGCAGAAGTATATCAGT and AAGGGCGACACGGAAATGTTGAATACTAGTTTAGCGGGATGCTCGTTG, bdb 945215 ATGCTTCAATAATATTGAAAAAGGAAGAGTATGATCTGGAAACGCCATTTA, AATAAGGGCGACACGGAAATGTTGAATACTAGTTCATCCCAAAACTGCCG, YedX TGCTTCAATAATATTGAAAAAGGAAGAGTATGTTAAAGCGTTATTTAGTA, AAGGGCGACACGGAAATGTTGAATACTAGTTTAACTGCCACGATAGGT, Z0726 TGCTTCAATAATATTGAAAAAGGAAGAGTATGGCATTCAGTAATCCC, AATAAGGGCGACACGGAAATGTTGAATACTAGTTCATTGTGCCTCCTGCA, 2-isopropylmalate synthase (LeuA) TAAATGCTTCAATAATATTGAAAAAGGAAGAGTATGAGCCAGCAAGTC, AAGGGCGACACGGAAATGTTGAATACTAGTTCACACGGTTTCCTTGTTGTTT, Sulfate adenyltransferase subunit1 TAAATGCTTCAATAATATTGAAAAAGGAAGAGTATGAACACCGCACTTGCACA, AATAAGGGCGACACGGAAATGTTGAATACTAGTTTATTTATCCCCCAGCAAATC, Sulfate adenyltransferase subunit2 TAAATGCTTCAATAATATTGAAAAAGGAAGAGTATGGATCAAATACGAC, AATAAGGGCGACACGGAAATGTTGAATACTAGTTTAAAAATACCCCTGACGTT -lactamase (AmpC) TGCTTCAATAATATTGAAAAAGGAAGAGTATGTTCAAAACGACGCTCTG, AATAAGGGCGACACGGAAATGTTGAATACTAGTTTACTGTAGAGCGTTAAGA. DAM...”

c0672 hypothetical protein from Escherichia coli CFT073
27% identity, 93% coverage

• Transcriptome of uropathogenic Escherichia coli during urinary tract infection
  Snyder, Infection and immunity 2004
  • “...iroNb dut chuSb iroBb iucDb sitBb yncE rplI c4088 yoaG c3610b c0672 c2203 kpsEb entC srlE rnpA fimF gidA marR hmpA glnP c4090 srlB chuTb a b Fold changea P...”

UTI89_C0587 hypothetical protein from Escherichia coli UTI89
27% identity, 93% coverage

• Metabolic Requirements of Escherichia coli in Intracellular Bacterial Communities during Urinary Tract Infection Pathogenesis
  Conover, mBio 2016
  • “...fold and one of several proteins responsible for PA, phenylacetic acid PA degradation in bacteria UTI89_C0587 3.658836126 MbtH-like protein (domain found in antibiotic synthesis proteins) UTI89_C1994 yoaG 3.380447626 Hypothetical protein UTI89_C5112 ybcS2 3.232487202 Bacteriophage lambda lysozyme-like protein UTI89_C3386 gspC 2.910385132 Putative type II secretion protein GspC...”
  • “...pathogenesis, yeaR , yoaG , ybdB , gspC , srlA , UTI89_C4030, lacZ , and UTI89_C0587, were chosen for further study. yeaR , yeaR-yeaQ ( yeaR-Q ), gspC , srlA , UTI89_C4030, lacZ , and UTI89_C0587 deletion mutants were constructed in order to assess their effect...”

t2281 conserved hypothetical protein from Salmonella enterica subsp. enterica serovar Typhi Ty2
28% identity, 91% coverage

• Genome-wide Analysis of Salmonella enterica serovar Typhi in Humanized Mice Reveals Key Virulence Features
  Karlinsey, Cell host & microbe 2019
  • “...t4353 Vi polysaccharide biosynthesis protein 4.75 Iron acquisition/utilization/cluster repair entA t2270 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase 4.55 ybdZ t2281 conserved hypothetical protein 5.52 iroC t2669 putative ABC transporter protein 5.14 iroD t2670 putative ferric enterochelin esterase 5.66 iroE t2671 putative exported protein 2.32 iroN t2672 TonB-dependent outer membrane siderophore...”

STM0587 putative cytoplasmic protein from Salmonella typhimurium LT2
28% identity, 91% coverage

• Mapping and regulation of genes within Salmonella pathogenicity island 12 that contribute to in vivo fitness of Salmonella enterica Serovar Typhimurium
  Tomljenovic-Berube, Infection and immunity 2013
  • “...valW fepA 2.32 2.31 2.25 1.48E36 1.31E02 3.44E57 STM0587 STM3883 ybdZ rbsC 2.25 2.24 1.45E06 1.57E22 STM3808.S STM2068 STM0586 STM0509 STM0700 STM1424 STM3830...”

New Search

Statistics

How It Works

PaperBLAST builds a database of protein sequences that are linked to scientific articles. These links come from automated text searches against the articles in EuropePMC and from manually-curated information from GeneRIF, UniProtKB/Swiss-Prot, BRENDA, CAZy (as made available by dbCAN), BioLiP, CharProtDB, MetaCyc, EcoCyc, TCDB, REBASE, the Fitness Browser, and a subset of the European Nucleotide Archive with the /experiment tag. Given this database and a protein sequence query, PaperBLAST uses protein-protein BLAST to find similar sequences with E < 0.001.

To build the database, we query EuropePMC with locus tags, with RefSeq protein identifiers, and with UniProt accessions. We obtain the locus tags from RefSeq or from MicrobesOnline. We use queries of the form "locus_tag AND genus_name" to try to ensure that the paper is actually discussing that gene. Because EuropePMC indexes most recent biomedical papers, even if they are not open access, some of the links may be to papers that you cannot read or that our computers cannot read. We query each of these identifiers that appears in the open access part of EuropePMC, as well as every locus tag that appears in the 500 most-referenced genomes, so that a gene may appear in the PaperBLAST results even though none of the papers that mention it are open access. We also incorporate text-mined links from EuropePMC that link open access articles to UniProt or RefSeq identifiers. (This yields some additional links because EuropePMC uses different heuristics for their text mining than we do.)

For every article that mentions a locus tag, a RefSeq protein identifier, or a UniProt accession, we try to select one or two snippets of text that refer to the protein. If we cannot get access to the full text, we try to select a snippet from the abstract, but unfortunately, unique identifiers such as locus tags are rarely provided in abstracts.

PaperBLAST also incorporates manually-curated protein functions:

• Proteins from NCBI's RefSeq are included if a GeneRIF entry links the gene to an article in PubMed^®. GeneRIF also provides a short summary of the article's claim about the protein, which is shown instead of a snippet.
• Proteins from Swiss-Prot (the curated part of UniProt) are included if the curators identified experimental evidence for the protein's function (evidence code ECO:0000269). For these proteins, the fields of the Swiss-Prot entry that describe the protein's function are shown (with bold headings).
• Proteins from BRENDA, a curated database of enzymes, are included if they are linked to a paper in PubMed and their full sequence is known.
• Every protein from the non-redundant subset of BioLiP, a database of ligand-binding sites and catalytic residues in protein structures, is included. Since BioLiP itself does not include descriptions of the proteins, those are taken from the Protein Data Bank. Descriptions from PDB rely on the original submitter of the structure and cannot be updated by others, so they may be less reliable. (For SitesBLAST and Sites on a Tree, we use a larger subset of BioLiP so that every ligand is represented among a group of structures with similar sequences, but for PaperBLAST, we use the non-redundant set provided by BioLiP.)
• Every protein from EcoCyc, a curated database of the proteins in Escherichia coli K-12, is included, regardless of whether they are characterized or not.
• Proteins from the MetaCyc metabolic pathway database are included if they are linked to a paper in PubMed and their full sequence is known.
• Proteins from the Transport Classification Database (TCDB) are included if they have known substrate(s), have reference(s), and are not described as uncharacterized or putative. (Some of the references are not visible on the PaperBLAST web site.)
• Every protein from CharProtDB, a database of experimentally characterized protein annotations, is included.
• Proteins from the CAZy database of carbohydrate-active enzymes are included if they are associated with an Enzyme Classification number. Even though CAZy does not provide links from individual protein sequences to papers, these should all be experimentally-characterized proteins.
• Proteins from the REBASE database of restriction enzymes are included if they have known specificity.
• Every protein with an evidence-based reannotation (based on mutant phenotypes) in the Fitness Browser is included.
• Sequence-specific transcription factors (including sigma factors and DNA-binding response regulators) with experimentally-determined DNA binding sites from the PRODORIC database of gene regulation in prokaryotes.
• Putative transcription factors from RegPrecise that have manually-curated predictions for their binding sites. These predictions are based on conserved putative regulatory sites across genomes that contain similar transcription factors, so PaperBLAST clusters the TFs at 70% identity and retains just one member of each cluster.
• Coding sequence (CDS) features from the European Nucleotide Archive (ENA) are included if the /experiment tag is set (implying that there is experimental evidence for the annotation), the nucleotide entry links to paper(s) in PubMed, and the nucleotide entry is from the STD data class (implying that these are targeted annotated sequences, not from shotgun sequencing). Also, to filter out genes whose transcription or translation was detected, but whose function was not studied, nucleotide entries or papers with more than 25 such proteins are excluded. Descriptions from ENA rely on the original submitter of the sequence and cannot be updated by others, so they may be less reliable.

Except for GeneRIF and ENA, the curated entries include a short curated description of the protein's function. For entries from BioLiP, the protein's function may not be known beyond binding to the ligand. Many of these entries also link to articles in PubMed.

For more information see the PaperBLAST paper (mSystems 2017) or the code. You can download PaperBLAST's database here.

Changes to PaperBLAST since the paper was written:

• November 2023: incorporated PRODORIC and RegPrecise. Many PRODORIC entries were not linked to a protein sequence (no UniProt identifier), so we added this information.
• February 2023: BioLiP changed their download format. PaperBLAST now includes their non-redundant subset. SitesBLAST and Sites on a Tree use a larger non-redundant subset that ensures that every ligand is represented within each cluster. This should ensure that every binding site is represented.
• June 2022: incorporated some coding sequences from ENA with the /experiment tag.
• March 2022: incorporated BioLiP.
• April 2020: incorporated TCDB.
• April 2019: EuropePMC now returns table entries in their search results. This has expanded PaperBLAST's database, but most of the new entries are of low relevance, and the resulting snippets are often just lists of locus tags with annotations.
• February 2018: the alignment page reports the conservation of the hit's functional sites (if available from from Swiss-Prot or UniProt)
• January 2018: incorporated BRENDA.
• December 2017: incorporated MetaCyc, CharProtDB, CAZy, REBASE, and the reannotations from the Fitness Browser.
• September 2017: EuropePMC no longer returns some table entries in their search results. This has shrunk PaperBLAST's database, but has also reduced the number of low-relevance hits.

Many of these changes are described in Interactive tools for functional annotation of bacterial genomes.

Secrets

PaperBLAST cannot provide snippets for many of the papers that are published in non-open-access journals. This limitation applies even if the paper is marked as "free" on the publisher's web site and is available in PubmedCentral or EuropePMC. If a journal that you publish in is marked as "secret," please consider publishing elsewhere.

Omissions from the PaperBLAST Database

Many important articles are missing from PaperBLAST, either because the article's full text is not in EuropePMC (as for many older articles), or because the paper does not mention a protein identifier such as a locus tag, or because of PaperBLAST's heuristics. If you notice an article that characterizes a protein's function but is missing from PaperBLAST, please notify the curators at UniProt or add an entry to GeneRIF. Entries in either of these databases will eventually be incorporated into PaperBLAST. Note that to add an entry to UniProt, you will need to find the UniProt identifier for the protein. If the protein is not already in UniProt, you can ask them to create an entry. To add an entry to GeneRIF, you will need an NCBI Gene identifier, but unfortunately many prokaryotic proteins in RefSeq do not have corresponding Gene identifers.

References

PaperBLAST: Text-mining papers for information about homologs.
M. N. Price and A. P. Arkin (2017). mSystems, 10.1128/mSystems.00039-17.

Europe PMC in 2017.
M. Levchenko et al (2017). Nucleic Acids Research, 10.1093/nar/gkx1005.

Gene indexing: characterization and analysis of NLM's GeneRIFs.
J. A. Mitchell et al (2003). AMIA Annu Symp Proc 2003:460-464.

UniProt: the universal protein knowledgebase.
The UniProt Consortium (2016). Nucleic Acids Research, 10.1093/nar/gkw1099.

BRENDA in 2017: new perspectives and new tools in BRENDA.
S. Placzek et al (2017). Nucleic Acids Research, 10.1093/nar/gkw952.

The EcoCyc database: reflecting new knowledge about Escherichia coli K-12.
I. M. Keeseler et al (2016). Nucleic Acids Research, 10.1093/nar/gkw1003.

The MetaCyc database of metabolic pathways and enzymes.
R. Caspi et al (2018). Nucleic Acids Research, 10.1093/nar/gkx935.

CharProtDB: a database of experimentally characterized protein annotations.
R. Madupu et al (2012). Nucleic Acids Research, 10.1093/nar/gkr1133.

The carbohydrate-active enzymes database (CAZy) in 2013.
V. Lombard et al (2014). Nucleic Acids Research, 10.1093/nar/gkt1178.

The Transporter Classification Database (TCDB): recent advances
M. H. Saier, Jr. et al (2016). Nucleic Acids Research, 10.1093/nar/gkv1103.

REBASE - a database for DNA restriction and modification: enzymes, genes and genomes.
R. J. Roberts et al (2015). Nucleic Acids Research, 10.1093/nar/gku1046.

Deep annotation of protein function across diverse bacteria from mutant phenotypes.
M. N. Price et al (2016). bioRxiv, 10.1101/072470.