PaperBLAST
PaperBLAST Hits for SMc00573 (78 a.a., MSDIAERVKK...)
Show query sequence
>SMc00573
MSDIAERVKKIVIDHLGVDAEKVSEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA
DSILTVGDAVKFIEKAQA
Running BLASTp...
Found 216 similar proteins in the literature:
SMc00573 ACYL CARRIER PROTEIN from Sinorhizobium meliloti 1021
100% identity, 100% coverage
Atu1096 acyl carrier protein from Agrobacterium tumefaciens str. C58 (Cereon)
97% identity, 100% coverage
RLV_4004 acyl carrier protein from Rhizobium leguminosarum bv. viciae
RL1559 putative acyl carrier protein (fatty acid synthase acyl carrier protein) from Rhizobium leguminosarum bv. viciae 3841
96% identity, 100% coverage
- Proteome Analysis Reveals a Significant Host-Specific Response in Rhizobium leguminosarum bv. viciae Endosymbiotic Cells
Durán, Molecular & cellular proteomics : MCP 2021 - “...RLV_1895B NifT/FixU_protein 69 128.6 n.d. RLV_1848 Glutamyl-tRNA_reductase 316 128.0 n.d. RLV_3309 ATP_synthase_subunit_b_1 164 126.2 146.4 RLV_4004 acyl_carrier_protein 79 125.0 - RLV_4846 ABC_transporter_ATP-binding_protein 252 124.2 59.1 RLV_7032 thioredoxin 107 123.8 185.7 RLV_969 putative_60_kDa_chaperonin 543 123.2 109.8 RLV_3266 molecular_chaperone_GroES 99 120.5 207.7 RLV_6777 aconitate_hydratase 897 120.4 43.3 RLV_4395...”
- Rhizobium leguminosarum Glutathione Peroxidase Is Essential for Oxidative Stress Resistance and Efficient Nodulation
Hu, Frontiers in microbiology 2021 - “...pRL80022 Cytoplasmic Alpha/beta hydrolase 35.12 0.78 0.0461 RL3549 glnII Cytoplasmic Glutamine synthetase 38.76 0.64 0.0118 RL1559 acpP Cytoplasmic Acyl carrier protein 8.37 0.83 0.0301 pRL100169 rhiA Extracellular Rhizosphere expressed protein RhiA 24.89 0.82 0.0018 RL0843 rlmE Cytoplasmic Ribosomal RNA large subunit methyltransferase E 26.45 0.81 0.0306...”
- “...in metabolic homeostasis. In addition, RL3549 codes for glutamine synthetase involved in assimilation of ammonium, RL1559 codes for the acyl carrier protein required for the biosynthesis of lipid A, and pRL100169 is a rhizosphere-expressed gene rhiA . These three genes have been reported by others to...”
- Antioxidant ability of glutaredoxins and their role in symbiotic nitrogen fixation in Rhizobium leguminosarum bv. viciae 3841
Zou, Applied and environmental microbiology 2021 (secret) - BacA is essential for bacteroid development in nodules of galegoid, but not phaseoloid, legumes
Karunakaran, Journal of bacteriology 2010 - “...(RL4430) (2.9-fold downregulated, P 0.004), ACP (AcpP, RL1559) (2.7-fold downregulated, P 0.03), lipoyl synthase (RL2249) (3.1-fold downregulated, P 0.01),...”
Oant_0572 acyl carrier protein from Brucella anthropi ATCC 49188
BAB1_0484 Acyl carrier protein (ACP):Phosphopantetheine attachment site:Phosphopantetheine-binding domain from Brucella melitensis biovar Abortus 2308
BMEI1475 ACYL CARRIER PROTEIN from Brucella melitensis 16M
Oant_0572 acyl carrier protein from Ochrobactrum anthropi ATCC 49188
88% identity, 100% coverage
- The differential interaction of Brucella and ochrobactrum with innate immunity reveals traits related to the evolution of stealthy pathogens
Barquero-Calvo, PloS one 2009 - “...[77] BAB2_0131 Absent lpxE-2 PA-phosphatase related phosphoesterase BAB1_0874 Oant_2371 acpXL-1 99100 Acyl carrier protein BAB1_0484 Oant_0572 acpXL-2 100100 Acyl carrier protein BAB1_0870 Oant_2375 lpxXL 9296 Bacterial lipid A biosynthesis acyltransferase Present 4 Oant_1613 lpxO 99100 lipid A-myristate -hydroxylase Lipoproteins 5 BAB1_1930 Oant_0928 omp19 8994 Omp19 Deletion...”
- Proteomics-based confirmation of protein expression and correction of annotation errors in the Brucella abortus genome
Lamontagne, BMC genomics 2010 - “...BAB1_1130 ClpA/B BAB1_1804 MarR family BAB2_0358 Dcp BAB1_0482 FabD BAB1_1132 ClpP BAB1_1810 AtpH BAB2_0361 TypA BAB1_0484 AcpP BAB1_1156 KdsA BAB1_1813 Transaldolase BAB2_0365 FbaA BAB1_0489 Guanylate kinase BAB1_1157 PyrG BAB1_1815 LeuS BAB2_0366 RpiB/LacA/LacB BAB1_0510 ThrC BAB1_1161 TpiA BAB1_1819 ACAT BAB2_0367 TIM 2 BAB1_0525 PpdK BAB1_1164 TrpC BAB1_1824...”
- The differential interaction of Brucella and ochrobactrum with innate immunity reveals traits related to the evolution of stealthy pathogens
Barquero-Calvo, PloS one 2009 - “..., [77] BAB2_0131 Absent lpxE-2 PA-phosphatase related phosphoesterase BAB1_0874 Oant_2371 acpXL-1 99100 Acyl carrier protein BAB1_0484 Oant_0572 acpXL-2 100100 Acyl carrier protein BAB1_0870 Oant_2375 lpxXL 9296 Bacterial lipid A biosynthesis acyltransferase Present 4 Oant_1613 lpxO 99100 lipid A-myristate -hydroxylase Lipoproteins 5 BAB1_1930 Oant_0928 omp19 8994 Omp19...”
- Ontology-based Brucella vaccine literature indexing and systematic analysis of gene-vaccine association network
Hur, BMC immunology 2011 - “...metabolites biosynthesis, transport and catabolism BMEI1111 acpXL acyl carrier protein 5 2 (0) C (9.97) BMEI1475 acpP acyl carrier protein 5 1 (0) C (9.26) BMEI0546 pncA pyrazinamidase/nicotinamidase 2 1 (0) V C (9.97) Cell wall/membrane/envelope biogenesis BMEI1829 ropB outer membrane protein, putative 23 37 (17)...”
- “...5 2 (0) C (9.97) BMEI1553 bacA transport protein 9 5 (4) V CM (10.00) BMEI1475 acpP acyl carrier protein 5 1 (0) C (9.26) Carbohydrate transport and metabolism BMEII0983 chvE sugar ABC transporter, periplasmic sugar-binding protein, putative 9 1 (1) U (5.02) BMEI1394 manA mannose-6-phosphate...”
- The lipopolysaccharide of Brucella abortus BvrS/BvrR mutants contains lipid A modifications and has higher affinity for bactericidal cationic peptides
Manterola, Journal of bacteriology 2005 - “...and 5-ACG CCGAATTCTTCTTCAAA-3 for ORF BMEI1475 (acpXL gene), and 5-GG CCGATTTTGCAGGCATTG-3 and 5-TCGGCAGCGTGCTGACCTTT-3 for ORF BMEI1553...”
- “...sequences (13, 56) reveals two ORFs (BMEI1111 and BMEI1475) whose products display 95% and 66% similarity to the rhizobial AcpXL, the specialized acyl carrier...”
B488_10110 acyl carrier protein from Liberibacter crescens BT-1
81% identity, 100% coverage
Dshi_2181 acyl carrier protein from Dinoroseobacter shibae DFL 12
77% identity, 99% coverage
CC_1677 acyl carrier protein from Caulobacter crescentus CB15
77% identity, 100% coverage
- Specialized acyl carrier protein used by serine palmitoyltransferase to synthesize sphingolipids in Rhodobacteria
Padilla-Gómez, Frontiers in microbiology 2022 - “...BL21(DE3) required for sphingolipid biosynthesis contain a 4'-phosphopantetheine prosthetic group Besides the housekeeping AcpP proteins (CC_1677 in C. crescentus and ECD_01090 in E. coli BL21(DE3)), both bacteria possess a structural gene for putative ACPs (CC_1163 and ECD_02853, respectively), located just upstream of their respective spt genes....”
- “...overexpressed proteins were detected. Also, the putative ACPs (ECD_02853 = AcpR Ec , lane 2; CC_1677 = AcpP Cc , lane 4; CC_1163 = AcpR Cc , lane 5) displayed radiolabeled bands that had similar relative mobility as the overexpressed protein bands ( Figure 2 ),...”
Saro_1339 acyl carrier protein from Novosphingobium aromaticivorans DSM 12444
74% identity, 100% coverage
- Whole genome-scale assessment of gene fitness of Novosphingobium aromaticavorans during spaceflight
Sharma, BMC genomics 2023 - “...found significant in all three analytical techniques. However, in the AI-1 dataset, one significant gene, saro_1339 , was found common for log 2 -fold change, Cooks distance and Welchs t-test at p0.05. This gene, associated with lipid metabolism and transport and encodes an acyl carrier protein...”
- “...activity, a on ester bonds Saro_1063 0.48046069 0.278912913 Yes 0.008205582 ISS hypothetical protein hypothetical protein Saro_1339 0.454544094 0.234475765 Yes 0.029067257 ISS acyl carrier protein [I] Lipid transport and metabolism [Q] Secondary metabolites biosynthesis, transport and catabolism Transports the growing fatty acid chain between enzyme domains of...”
- Top-Down Characterization of the Post-Translationally Modified Intact Periplasmic Proteome from the Bacterium Novosphingobium aromaticivorans
Wu, International journal of proteomics 2013 - “...None Removal of met Disulfide bond Saro_1346 (2Fe-2S)-binding protein None Removal of met Disulfide bond Saro_1339 Acyl carrier protein None Removal of met Modification (382Da) Saro_2520 BolA-like protein None Removal of met Saro_0034 Chaperonin Cpn10 None Removal of met Saro_2299 Conserved hypothetical protein None Removal of...”
ZZ6_0066 acyl carrier protein from Zymomonas mobilis subsp. mobilis ATCC 29191
ZMO1279 acyl carrier protein from Zymomonas mobilis subsp. mobilis ZM4
69% identity, 100% coverage
- pZMO7-Derived shuttle vectors for heterologous protein expression and proteomic applications in the ethanol-producing bacterium Zymomonas mobilis
So, BMC microbiology 2014 - “...of pZ7C plasmid to produce pZ7-GST (Figure 2 ). The acyl-carrier protein ( acpP , ZZ6_0066); chaperone protein DnaJ (ZZ6_0618), RNA chaperone protein Hfq (ZZ6_0899), DNA polymerase III chi subunit ( holC , ZZ6_0042) and 2-dehydro-3-deoxyphosphooctonate aldolase protein ( kdsA , ZZ6_1604) genes were PCR amplified...”
- “...proteins for expression analysis and binding-interaction analysis in the ATCC 29191 strain: acyl-carrier protein (AcpP, ZZ6_0066; 78 aa), 2-dehydro-3-deoxyphosphooctonate aldolase (KdsA, ZZ6_1604; 292 aa), chaperone protein DnaJ (ZZ6_0618; 375 aa), RNA chaperone Hfq (ZZ6_0899; 161 aa) and DNA polymerase III chi subunit (HolC, ZZ6_0042; 148 aa)....”
- pZMO7-Derived shuttle vectors for heterologous protein expression and proteomic applications in the ethanol-producing bacterium Zymomonas mobilis
So, BMC microbiology 2014 - “...(ZMO0347) were both up-regulated in response to stress, whilst levels of the KdsA (ZMO1488), AcpP (ZMO1279) were unchanged. Expression of the HolC DNA polymerase III chi subunit (ZMO1308) was not detected. A targeted protein-affinity pull-down approach such as the one described here may be used to...”
PB7211_217 acyl carrier protein from Candidatus Pelagibacter sp. HTCC7211
76% identity, 91% coverage
- mdRNA-Seq analysis of marine microbial communities from the northern Red Sea
Hou, Scientific reports 2016 - “...domain protein PB7211_401 PB7211_401 362111 362674 + 303 307 acid tolerance regulatory protein actr acpP PB7211_217 613491 613746 + 292 124 acyl carrier protein ahcY PB7211_1045 368453 369739 + 291 632 adenosylhomocysteinase PB7211_767 PB7211_767 1161417 1163849 284 257 dimethylglycine dehydrogenase rpoZ PB7211_373 739908 740423 + 265...”
SAR11_0708 Acyl carrier protein (ACP) from Candidatus Pelagibacter ubique HTCC1062
75% identity, 90% coverage
P0A2W3 holo-[acyl-carrier-protein] synthase (EC 2.7.8.7) from Vibrio harveyi (see paper)
M892_16425 acyl carrier protein from Vibrio campbellii ATCC BAA-1116
62% identity, 99% coverage
A4Y5S5 Acyl carrier protein from Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
62% identity, 99% coverage
VF_1739 acyl carrier protein from Vibrio fischeri ES114
VF_1739 acyl carrier protein from Aliivibrio fischeri ES114
61% identity, 99% coverage
PMI0862 acyl carrier protein from Proteus mirabilis HI4320
63% identity, 97% coverage
Avin_14930 acyl carrier protein from Azotobacter vinelandii AvOP
64% identity, 94% coverage
Alvin_1890 acyl carrier protein from Allochromatium vinosum DSM 180
62% identity, 100% coverage
I4VIC2 Acyl carrier protein from Rhodanobacter sp. 115
66% identity, 92% coverage
PA2966 acyl carrier protein from Pseudomonas aeruginosa PAO1
O54439 Acyl carrier protein 1 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
PA14_25670 acyl carrier protein from Pseudomonas aeruginosa UCBPP-PA14
64% identity, 94% coverage
- BatR: A novel regulator of antibiotic tolerance inPseudomonas aeruginosabiofilms
Piazza, 2024 - Backbone <sup>1</sup>H, <sup>13</sup>C and <sup>15</sup>N assignments of the apo-acyl carrier protein (ACP<sub>1</sub>) of Pseudomonas aeruginosa
Rizzo, Biomolecular NMR assignments 2023 - “...sequence alignment of the ACPs found in Pseudomonas aeruginosa . The open reading frames PA1869, PA2966, PA3334 code for ACP 1 , ACP 2 (ACP P ) and ACP 3 respectively. Conservation is shown in shades of blue, with darker blue indicating the sequence identity. Figure...”
- The Breadth and Molecular Basis of Hcp-Driven Type VI Secretion System Effector Delivery
Howard, mBio 2021 - “...which are significant Hcp2-specific interacting partners with molecular weights below that of Tse3 (PA2066 and PA2966) and 63 proteins enriched 3-fold by Hcp3, 9 of which are significant Hcp3-specific interacting partners with molecular weights below that of Tse3 (PA0256, PA3187, PA2372 [a 21-kDa protein of unknown...”
- “...10 2.71 Hypothetical, YdcF family protein 23.9 PA4226 PchE 4.4 1.52 Dihydroaeruginoic acid synthetase 156.4 PA2966 AcpP 3.1 1.35 Acyl carrier protein 8.7 a Hits are ordered by fold change, which is the difference between the Hcp-FLAG pulldown and the Hcp untagged pulldown. All hits were...”
- Transcriptomic determinants of the response of ST-111 Pseudomonas aeruginosa AG1 to ciprofloxacin identified by a top-down systems biology approach
Molina-Mora, Scientific reports 2020 - “...score* logFC 2.5h* logFC 5h* Co-expression module KEGG Annotation** Annotation details Other studies*** PaeAG1_01864 acpP (PA2966) 6,268.3 17 2.64 3.63 Turquoise Metabolic pathways, biosynthesis of antibiotics Acyl carrier protein; fatty acid biosynthesis AZM, CIP COL PaeAG1_06246 ygaU 6,340.4 1.79 0.9 Blue LysM domain/BON superfamily protein PaeAG1_04068...”
- Modulation of antibiotic sensitivity and biofilm formation in Pseudomonas aeruginosa by interspecies signal analogues
An, Nature communications 2019 - “...medium reduced the level of expression seen with DSF alone and in some cases (e.g. PA2966, PA5505 ) the effects on expression were reversed (Fig. 3d ). These experiments were repeated with the PA1396 mutant strain, demonstrating that the addition of DSF or C23 had no...”
- Acyl Carrier Protein 3 Is Involved in Oxidative Stress Response in Pseudomonas aeruginosa
Chen, Frontiers in microbiology 2018 - “...and Deretic, 1996 ). The P. aeruginosa genome contains three putative acp genes, annotated as PA2966 ( acpP ), PA1869 ( acp1 ), and PA3334 ( acp3 ). Each contains a conserved serine that is presumed to be the site of 4-phosphopantetheinylation ( Raychaudhuri et al.,...”
- Only Acyl Carrier Protein 1 (AcpP1) Functions in Pseudomonas aeruginosa Fatty Acid Synthesis
Ma, Frontiers in microbiology 2017 - “...not comply with these terms. The genome of Pseudomonas aeruginosa contains three open reading frames, PA2966, PA1869, and PA3334, which encode putative acyl carrier proteins, AcpP1, AcpP2, and AcpP3, respectively. In this study, we found that, although these apo-ACPs were successfully phosphopantetheinylated by P. aeruginosa phosphopantetheinyl...”
- “...contains three open reading frames annotated as encoding ACP ( Murugan et al., 2010 ). PA2966 (now named acpP1 ) encodes AcpP1, which is found in the fatty acid biosynthetic gene cluster ( Kutchma et al., 1999 ). PA1869 (now named acpP2 ) is the second...”
- Bacterial cis-2-unsaturated fatty acids found in the cystic fibrosis airway modulate virulence and persistence of Pseudomonas aeruginosa
Twomey, The ISME journal 2012 - “...PA1326 PA1327 PA1467 PA1559 PA1560 PA1797 PA1889 PA2339 PA2966 PA3790 PA4138 PA4357 PA4358 PA4359 PA4599 PA4773 PA4774 PA4775 PA4776 PA4777 PA4781 PA4782 PA4898...”
- “...transcript levels of other DSF-responsive genes (PA0806, PA1560, PA2966) were not altered in the PA1396 mutant (Supplementary Figure S8). This may suggest the...”
- More
- Proteomic Analysis of Resistance of Gram-Negative Bacteria to Chlorhexidine and Impacts on Susceptibility to Colistin, Antimicrobial Peptides, and Ceragenins
Hashemi, Frontiers in microbiology 2019 - “...the elongation cycle of fatty acid synthesis (FAS II). Fatty acid biosynthetic process 87.20 26 O54439 Acyl carrier protein 1 (AcpP1) Fatty acid chain carrier. Lipid A biosynthetic process 46.21 27 P53593 SuccinateCoA ligase [ADP-forming] subunit beta (sucC) Provides succinate binding specificity in the coupling of...”
- Bacteria possessing two RelA/SpoT-like proteins have evolved a specific stringent response involving the acyl carrier protein-SpoT interaction
Battesti, Journal of bacteriology 2009 - “...CTACTCGAGAAGCTTATTGCTGGGGAGCAACGATGTAG acp1Pae O54439 Ebm372 Ebm373 CACCGAATTCATGGACGACATCGAGACCAGAGTG ACCGATCGATAAGCTTCAGGTCGGCACGGCTTCC...”
- Identification of the alternative sigma factor SigX regulon and its implications for Pseudomonas aeruginosa pathogenicity
Blanka, Journal of bacteriology 2014 - “...PA14_17220 PA14_17270 PA14_20750 PA14_25650 PA14_25660 PA14_25670 PA14_25900 PA14_40560 PA14_41575 PA14_41590 PA14_42310 PA14_42350 PA14_42380 PA14_42400...”
AKJ12_RS05780, XC_RS16265 acyl carrier protein from Xanthomonas arboricola pv. juglandis
63% identity, 92% coverage
- Transcriptional profiling of Xanthomonas campestris pv. campestris in viable but nonculturable state
Bai, BMC genomics 2023 - “...and metabolism XC_RS04900 pyk 1.45 1.15 0.62 pyruvate kinase XC_RS15295 katG 1.23 1.10 1.14 catalase/peroxidase XC_RS16265 acpP 3.40 2.39 1.35 acyl carrier protein XC_RS09690 guaB 1.78 1.43 0.89 IMP dehydrogenase XC_RS01110 - a 1.67 1.51 0.41 Fic family protein XC_RS20570 - a 1.74 1.63 1.30 ABC...”
- Proteome Analysis of Walnut Bacterial Blight Disease
H, International journal of molecular sciences 2020 - “...(AKJ12_RS20070 and AKJ12_RS13810); endoglucanase (AKJ12_RS08070); two phospholipases (AKJ12_RS07015 and AKJ12_RS03905); five phosphatases (AKJ12_RS09730, AKJ12_RS09895, AKJ12_RS11635, AKJ12_RS05780, and AKJ12_RS13650); alpha-xylosidase (AKJ12_RS09825); xylose isomerase (AKJ12_RS20500); four hydrolases (AKJ12_RS18195, AKJ12_RS14795, AKJ12_RS12205, and AKJ12_RS12930); four aminopeptidases (AKJ12_RS15095, AKJ12_RS13855, AKJ12_RS05625, and AKJ12_RS04085); and biotin carboxylase (AKJ12_RS08585). In addition, we highlighted argininosuccinate...”
DP16_RS17255 acyl carrier protein from Stenotrophomonas maltophilia
64% identity, 92% coverage
P80923 Acyl carrier protein from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
62% identity, 100% coverage
acpP / P0A6A8 acyl carrier protein from Escherichia coli (strain K12) (see 5 papers)
ACP_ECOLI / P0A6A8 Acyl carrier protein; ACP; Cytosolic-activating factor; CAF; Fatty acid synthase acyl carrier protein from Escherichia coli (strain K12) (see paper)
AcpP / ECOCYC|LIPOYL-ACP acyl carrier protein (ACP) from Escherichia coli K12 (see 2 papers)
acpP acyl carrier protein from Escherichia coli K12 (see 14 papers)
P0A6B1 Acyl carrier protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
NP_415612 acyl carrier protein from Escherichia coli str. K-12 substr. MG1655
P0A6B2 Acyl carrier protein from Salmonella typhi
STM1196 acyl carrier protein from Salmonella typhimurium LT2
b1094 acyl carrier protein from Escherichia coli str. K-12 substr. MG1655
ECP_1086 acyl carrier protein from Escherichia coli 536
c1364 Acyl carrier protein from Escherichia coli CFT073
ESA_02251 hypothetical protein from Enterobacter sakazakii ATCC BAA-894
S1178 acyl carrier protein from Shigella flexneri 2a str. 2457T
SPA1655 acyl carrier protein from Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150
ECD_01090, OI124_07875, SF5M90T_1094 acyl carrier protein from Shigella flexneri 5a str. M90T
62% identity, 100% coverage
- function: Carrier of the growing fatty acid chain in fatty acid biosynthesis
subunit: Interacts with MukB. - N-dodecanoyl-homoserine lactone influences the levels of thiol and proteins related to oxidation-reduction process in Salmonella
de, PloS one 2018 - “...accB Biosynthetic 2.049 0.841 ND ND -10.547 1.542 ND ND -1.505 1.241 Acyl carrier protein P0A6B1 acpP Biosynthetic 1.930 1.139 -0.409 0.737 -0.439 0.714 -0.277 1.882 -0.452 1.297 ATP synthase subunit beta Q7CPE2 atpD Biosynthetic ND ND ND ND -7.974 1.357 ND ND ND ND Cell...”
- Interfacial plasticity facilitates high reaction rate of E. coli FAS malonyl-CoA:ACP transacylase, FabD.
Misson, Proceedings of the National Academy of Sciences of the United States of America 2020 - GeneRIF: Interfacial plasticity facilitates high reaction rate of E. coli FAS malonyl-CoA:ACP transacylase, FabD.
- The conserved modular elements of the acyl carrier proteins of lipid synthesis are only partially interchangeable.
Zhu, The Journal of biological chemistry 2015 - GeneRIF: analysis of acyl carrier protein conserved modular elements and their roles in lipid synthesis
- Chasing acyl carrier protein through a catalytic cycle of lipid A production.
Masoudi, Nature 2014 - GeneRIF: crystal structures of three forms of Escherichia coli acyl carrier protein engaging LpxD, which represent stalled substrate and liberated products along the reaction coordinate
- Crystal structures of acyl carrier protein in complex with two catalytic partners show a dynamic role in cellular metabolism.
Newmister, Chembiochem : a European journal of chemical biology 2014 - GeneRIF: The studies highlight key interactions of transient ACP-LpxD protein complexes and define the dynamic movements of ACP that facilitate substrate delivery and trigger complex dissociation.
- Intein-mediated cyclization of bacterial acyl carrier protein stabilizes its folded conformation but does not abolish function.
Volkmann, The Journal of biological chemistry 2010 - GeneRIF: ACP must be able to adopt a folded conformation for biological activity, and its function does not require complete unfolding of the protein
- Structural modification of acyl carrier protein by butyryl group.
Wu, Protein science : a publication of the Protein Society 2009 - GeneRIF: solution structures determined of three different forms of ACP, apo-ACP, ACP, and butyryl-ACP under identical experimental conditions; structural studies revealed that attachment of butyryl acyl intermediate to ACP alters the conformation of ACP
- Catalysis and mechanism of malonyl transferase activity in type II fatty acid biosynthesis acyl carrier proteins.
Misra, Molecular bioSystems 2009 (PubMed)- GeneRIF: Studies shed light on a key aspect of ACP biology and provide insights into the mechanism involved.
- Structural studies of fatty acyl-(acyl carrier protein) thioesters reveal a hydrophobic binding cavity that can expand to fit longer substrates.
Roujeinikova, Journal of molecular biology 2007 (PubMed)- GeneRIF: The acyl moiety is attached via a thioester bond to a phosphopantetheine linker that is in turn bound to a serine residue in Acyl Carrier Protein (ACP), the growing acyl chain can be accommodated within a central cavity in the ACP.
- More
- Structural assembly of the bacterial essential interactome
Gómez, eLife 2024 - “...toward the binding pockets of both FabG and FabI. Uniprot codes used for AF2: AcpP: P0A6A8, fabG: P0AEK2, fabI: P0AEK4. Currently, the structure of the BirA-AccB binary complex remains unsolved. Hence, our model provides valuable functional insights into this complex. We show that the BPL catalytic...”
- “...Ser36 in red. Uniprot codes used for AF2: GlmU: P0ACC7, LpxA: P0A722, LpxD: P21645, AcpP: P0A6A8. Figure 4figure supplement 1. Electrostatic potentials of AlphaFold2 (AF2) predicted models for the GlmU-AcpP ( a ), LpxA-AcpP, ( b ), and LpxD-AcpP ( c ) complexes. In all three...”
- Simulation-based Reconstructed Diffusion unveils the effect of aging on protein diffusion in Escherichia coli
Mantovanelli, PLoS computational biology 2023 - “...0.4 2.4 0.5 AceB P08997 85.9 7.0 1.3 5.8 1.4 7.9 1.4 7.2 1.8 AcpP P0A6A8 34.3 9.5 1.7 7.5 1.3 11.2 2.7 9.6 1.9 ErpA P0ACC3 75.5 7.5 0.7 5.5 0.9 8.5 1.0 6.7 1.4 TrxA P0AA25 37.5 8.3 1.5 6.2 1.3 9.4 1.9 7.8...”
- Biodistribution of 89Zr-DFO-labeled avian pathogenic Escherichia coli outer membrane vesicles by PET imaging in chickens
Li, Poultry science 2023 - “...GLPD Energy production and conversion Cytoplasm 175 P0A8F4 URK Nucleotide transport and metabolism Cytoplasm 176 P0A6A8 ACP Function unknown Cytoplasm 177 P0A6A3 ACKA Energy production and conversion Cytoplasm 178 P0AED0 USPA Signal transduction mechanisms Cytoplasm 179 P0A9F3 CYSB Transcription Cytoplasm 180 P0AGD7 SRP54 Intracellular trafficking, secretion,...”
- Control of Unsaturation in De Novo Fatty Acid Biosynthesis by FabA
Bartholow, Biochemistry 2022 - “...Magnetic Research Bank under the ascension codes: 50699 and 50700. E. coli AcpP, UniProt entry P0A6A8; E. coli 3-hydroxydecanoyl-dehydratase FabA, Uniprot entry P0A6Q3. ABBREVIATIONS ACP Acyl carrier protein AcpP The E. coli carrier protein FAB Fatty acid biosynthesis FabA The E. coli isomerizing 3-hydroxydecanoyl dehydratase HSQC...”
- Engineered Chimeras Unveil Swappable Modular Features of Fatty Acid and Polyketide Synthase Acyl Carrier Proteins
Cho, Biochemistry 2022 - “...Accession codes (UniProt) for proteins in this study are as follows: FabF KS: P0AAI5, AcpP: P0A6A8, ACT ACP: Q02054. Supplementary Material Cho et al SI Funding Sources We are grateful to the National Institutes of Health (R15GM120704 to L.K.C.) and Beckman Scholarship (G.H.S.) for funding this...”
- Protein diffusion in Escherichia coli cytoplasm scales with the mass of the complexes and is location dependent
Śmigiel, Science advances 2022 - “...318.9 2.9 0.5 11 P08997 AceB 28 8,308 10.400 60.2 1 85.9 6.9 1.1 12 P0A6A8 AcpP 38 28,863 0.120 8.6 1 34.3 9.6 1.6 13 P0ACC3 ErpA 22 3,460 0.100 12.1 2 75.5 7.8 1.1 15 P0AA25 TrxA 33 18,242 0.025 11.8 1 37.5 8.7...”
- Activity Mapping the Acyl Carrier Protein: Elongating Ketosynthase Interaction in Fatty Acid Biosynthesis
Mindrebo, Biochemistry 2020 - “...of FabF variants and C12-AcpP .Accession Codes. Escherichia coli FabF: P0AAI5 (Uniprot) Escherichia coli AcpP: P0A6A8 (Uniprot) References (1) Beld J , Lee DJ , and Burkart MD ( 2015 ) Fatty acid biosynthesis revisited: structure elucidation and metabolic engineering . Mol. Biosyst 11 , 38...”
- Colorimetric Assay Reports on Acyl Carrier Protein Interactions.
Acheampong, Scientific reports 2019 - “...pXY-FabF 36 , respectively. UNIPROT accession numbers for the proteins used in this work are P0A6A8 ( E . coli AcpP); Q02054 (ACT ACP); and P0AA16 (FabF). To express ACT ACP C17S to direct the regiospecificity of TNB addition, pKJ5573 was constructed via Q5 site-directed mutagenesis...”
- More
- A dedicated C-6 β-hydroxyacyltransferase required for biosynthesis of the glycolipid anchor for Vi antigen capsule in typhoidal Salmonella
Liston, The Journal of biological chemistry 2022 - “...ACP was generated using ColabFold, using single copies of the sequences UNIprot P43112 (VexE) and P0A6B2 (ACP) as input. Note that while the AlphaFold Achromobacter VexE model (AF-A0A160EBU3-F1) has similar confidence scores, the acyl-binding tunnel is occluded by a rotation and repositioning of 28. ColabFold produces...”
- Conserved intergenic sequences revealed by CTAG-profiling in Salmonella: thermodynamic modeling for function prediction
Tang, Scientific reports 2017 - “...between yajB and queA 500950 STM0445 & STM0446 intergenic region between yajG and bolA 1280403 STM1196 & STM1197 intergenic region between acpP and fabF 1280562 STM1197 3-oxoacyl-[acyl-carrier-protein] synthase II 1459628 STM1377 & STM1378 intergenic region between lpp and pykF 1519898 STM1444 transcriptional regulator SlyA 1794367 STM1702...”
- Transcriptional and proteomic responses of Pseudomonas aeruginosa PAO1 to spaceflight conditions involve Hfq regulation and reveal a role for oxygen
Crabbé, Applied and environmental microbiology 2011 - “...in S. Typhimurium Gene name PA2966 PA3531 PA3656 PA3744 STM1196 STM3443 STM0216 STM2675 acpP bfrB rpsB rimM PA4031 PA4053 STM4414 STM0417 ppa ribH PA4248 PA4259...”
- Media ion composition controls regulatory and virulence response of Salmonella in spaceflight
Wilson, PloS one 2008 - “...portion of basal-body rod STM1179 0.47 x flgG flagellar biosynthesis, cell-distal portion of basal-body rod STM1196 0.59 x acpP acyl carrier protein STM1466 0.59 ydgA putative periplasmic protein STM1916 0.55 x cheY chemotaxis regulator, transmits chemoreceptor signals to flagellar motor STM1959 0.44 x fliC flagellar biosynthesis;...”
- A bacterial methyltransferase that initiates biotin synthesis, an attractive anti-ESKAPE druggable pathway
Su, Science advances 2024 - “...residue serine-36 of ACP ( 82 ). Before the tag-free ACP production with pBAD24 ::acpP (b1094), pET28a ::acpH (b0404) was created to give the N-terminal hexahistidine (6x His)fused AcpH version (table S2) ( 82 ). B. subtilis Sfp (Ppan transferase)encoding gene sfp was amplified with PCR...”
- Flux balance impact degree: a new definition of impact degree to properly treat reversible reactions in metabolic networks
Zhao, Bioinformatics (Oxford, England) 2013 - “...bacterial lipid flippase whose knock-out blocks ATP synthesis by oxidative phosphorylation, or 448 for acpP (b1094), a acyl carrier protein that catalyzes polyketide biosynthesis of holo-ACPS; unsurprisingly, both are essential genes. Fig. 2. FBID distribution for the 1366 genes of the KEIO collection dataset computed on...”
- Analysis of phage Mu DNA transposition by whole-genome Escherichia coli tiling arrays reveals a complex relationship to distribution of target selection protein B, transcription and chromosome architectural elements
Ge, Journal of biosciences 2011 - “...276449 1.7 mmuM b0261 1 430474 431171 1.7 tsx b0411 2 1150750 1151231 1.7 acpP b1094 3 1715057 1715202 1.7 tyrS b1637 4 1797488 1798185 1.7 rpIT b1716 5 2175874 2177627 1.7 yegT b2098 6 2312108 2315397 1.7 rcsB b2217 7 3717935 3718224 1.55 cspA b3556...”
- Genome-scale analysis to the impact of gene deletion on the metabolism of E. coli: constraint-based simulation approach
Xu, BMC bioinformatics 2009 - “...b0421, b0423 b3774 b0954 b0915 b3359 b0475, b0750, b0907 b1093 b0918 b3433 b1096, b1208, b1210 b1094 b1094 b3809 b1277, b1662, b1740 b1288 b1215 s0001 b1812, b2103, b2153 b2323 b3198 b2315, b2320, b2400 b3176 b3633 b2515, b2530, b2564 b3189 b2574, b2615, b2746 b3729 b2747, b2763, b2764 b3730...”
- “...b0159 b0159 b0175 b0185 b0522, b0523 b2687 b0386 b2585 b1092 b0945, b1062 b2942 b2818 b3018 b1094 b1131, b1281 b3939 b3172 b4041 b2316 b2312, b2476 b4013 b3957 b4160 b2323 b2499, b2507 s0001 b3958 b3255 b2557, b2780 b3959 b3256 b3642, b4005 b3960 b4006, b4177 s0001 b4244, b4245 SS...”
- Protein disorder is positively correlated with gene expression in Escherichia coli
Paliy, Journal of proteome research 2008 - “...are predicted to be disordered by PONDR VL-XT. AcpP (b1094) - acyl carrier protein--Acyl carrier protein is a cytosolic protein of 77 amino acids in E. coli70....”
- “...SucB (b0727); D) Pal (b0741); E) InfA (b0884); F) AcpP (b1094); G) HNS (b1237); H) PtsI (b2416); I) GcvH (b2904); J) NusA (b3169); K) AccB (b3255); L) RpoZ...”
- Global gene expression profiling of the asymptomatic bacteriuria Escherichia coli strain 83972 in the human urinary tract
Roos, Infection and immunity 2006 - “...b1823 b3297 b0605 b2591 b3306 b3339 b3296 b3309 b3295 b1094 c2758 b3310 b3298 b3231 b2621 Z2747 b3320 b3123 b3341 b3299 b2779 b3782 b3983 b2579 b1677 b2153...”
- Comprehensive analysis of PNA-based antisense antibiotics targeting various essential genes in uropathogenic Escherichia coli
Popella, Nucleic acids research 2022 - “...- CTCATAATT -4 to+5 > 10 CTCATAATTT -5 to+5 10 CTCATAATTTA -6 to+5 10 acpP ECP_1086 12828.1 KFFKFFKFFK CTCATACT -3 to+5 5 CTCATACTC -4 to+5 1.25 CTCATACTCT -5 to+5 1.25 CTCATACTCTT -6 to+5 1.25 scrambled - - KFFKFFKFFK CACTATCT - > 10 CACTATCTC - > 10...”
- Sphingosine 1-phosphate signalling in mammalian cells
Pyne, The Biochemical journal 2000 (secret) - Comprehensive approaches to molecular biomarker discovery for detection and identification of Cronobacter spp. (Enterobacter sakazakii) and Salmonella spp
Yan, Applied and environmental microbiology 2011 - “...ESA_03753 ESA_00373 ESA_02807 ESA_03723 ESA_02187 ESA_02251 ESA_00752 ESA_00690 ESA_04401 ESA_03312 ESA_03973 ESA_03690 GU122171 ACE74909 ESA_00031 ESA_03979...”
- Addendum
, Open forum infectious diseases 2019 - Analysis of Salmonella enterica serotype paratyphi A gene expression in the blood of bacteremic patients in Bangladesh
Sheikh, PLoS neglected tropical diseases 2010 - “...sulfoxide reductase subunit C 9.98 0.0026 1.60 0.0495 1.45 0.0317 Fatty acid and phospholipid metabolism SPA1655 acpP Acyl carrier protein 9.57 0.0068 3.04 0.0237 3.05 0.0392 Hypothetical proteins SPA1739 yccD Conserved hypothetical protein 2.87 0.0041 2.45 0.0278 3.82 0.0461 Mobile and extrachromosomal element functions SPA3373 -...”
- Pathogenicity and identification of host adaptation genes of the avian pathogenic <i>Escherichia coli</i> O145 in duck
Tan, Frontiers in cellular and infection microbiology 2024 - “...K00111 Glycerol-3-phosphate dehydrogenase 5.73 0.0022 Glycerone-P, sn-Glycerol-3P OI124_04745 katE K03781 Catalase -19.32 0.0249 O 2 OI124_07875 acpP K02078 Acyl carrier protein -22.24 0.0444 2-Methylquinolin-4-ol OI124_08270 putA K13821 Proline dehydrogenase -18.45 0.0276 L-Glutamate OI124_11515 cyoE K02257 Heme o synthase -20.82 0.0198 Heme O OI124_15960 argB K00930 Acetylglutamate...”
- Specialized acyl carrier protein used by serine palmitoyltransferase to synthesize sphingolipids in Rhodobacteria
Padilla-Gómez, Frontiers in microbiology 2022 - “...contain a 4'-phosphopantetheine prosthetic group Besides the housekeeping AcpP proteins (CC_1677 in C. crescentus and ECD_01090 in E. coli BL21(DE3)), both bacteria possess a structural gene for putative ACPs (CC_1163 and ECD_02853, respectively), located just upstream of their respective spt genes. These four structural acp genes...”
- “...extracts by PAGE, radioactive bands were visualized ( Figure 2B ). For 4 known ACPs (ECD_01090 = AcpP Ec , lane 3; NodF, lane 6; AcpXL, lane 7; RkpF, lane 8), radiolabeled bands with similar relative mobility as the overexpressed proteins were detected. Also, the putative...”
- RNA-seq analysis of the influence of anaerobiosis and FNR on Shigella flexneri
Vergara-Irigaray, BMC genomics 2014 - “...SF5M90T_3957 birA biotin--protein ligase -1.62 -0.51 SF5M90T_2103 thiM hydoxyethylthiazole kinase -1.95 Lipid transport and metabolism SF5M90T_1094 acpP acyl carrier protein 1.70 -3.04 SF5M90T_2272 menE o-succinylbenzoate-CoA ligase 1.60 -1.54 -1.80 SF5M90T_2416 ucpA putative oxidoreductase 1.45 -0.56 SF5M90T_339 sbmA sensitivity to microcin B17, possibly envelope protein -1.64 Inorganic...”
PIOMA14_I_1387, PIOMA14_RS07075 acyl carrier protein from Prevotella intermedia
60% identity, 96% coverage
- Iron Deficiency Modulates Metabolic Landscape of Bacteroidetes Promoting Its Resilience during Inflammation
Lewis, Microbiology spectrum 2023 - “...0.006622 PIOMA14_RS06860 PIOMA14_I_1344 Hypothetical protein 2.2 0.031637 PIOMA14_RS07025 PIOMA14_I_1378 DUF3781 domain-containing protein 2.5 0.026707 PIOMA14_RS07075 PIOMA14_I_1387 Acyl carrier protein 3.9 5.15E-05 PIOMA14_RS07460 PIOMA14_I_1468 Heavy metal translocating P-type ATPase 42.7136.4 02.26E-08 PIOMA14_RS076707705 PIOMA14_I_15091516 TonB dep transpot system and TetR/AcrR transcriptional regulator 40.46222.63 06.99E-08 PIOMA14_RS0792055 PIOMA14_I_156572 TetR/AcrR family...”
- “...3.1 0.006622 PIOMA14_RS06860 PIOMA14_I_1344 Hypothetical protein 2.2 0.031637 PIOMA14_RS07025 PIOMA14_I_1378 DUF3781 domain-containing protein 2.5 0.026707 PIOMA14_RS07075 PIOMA14_I_1387 Acyl carrier protein 3.9 5.15E-05 PIOMA14_RS07460 PIOMA14_I_1468 Heavy metal translocating P-type ATPase 42.7136.4 02.26E-08 PIOMA14_RS076707705 PIOMA14_I_15091516 TonB dep transpot system and TetR/AcrR transcriptional regulator 40.46222.63 06.99E-08 PIOMA14_RS0792055 PIOMA14_I_156572 TetR/AcrR...”
YPTB2470 acyl carrier protein from Yersinia pseudotuberculosis IP 32953
YPO1600 acyl carrier protein from Yersinia pestis CO92
61% identity, 99% coverage
- Growth of Yersinia pseudotuberculosis in human plasma: impacts on virulence and metabolic gene expression
Rosso, BMC microbiology 2008 - “...putative acyl carrier protein 1.669 (0.048) YPTB2242 (acpD) YPO2323 acyl carrier protein phosphodiesterase 0.703 (0.013) YPTB2470 (acpP) YPO1600 acyl carrier protein 0.661 (0.002) YPTB2473 (fabH) YPO1597 3-oxoacyl-[acyl-carrier-protein] synthase III 0.757 (0.047) 0.708 (0.017) YPTB2626 (fabB) YPO2757 3-oxoacyl-[acyl-carrier-protein] synthase I 0.605 (0.009) YPTB2993 (lpxD) YPO1054 UDP-3-o-[3-hydroxymyristoyl] glucosamine...”
- “...YPTB1966 (hutI) YPO1972 imidazolonepropionase 0.632 (0.004) YPTB2064 YPO2082 putative fumarylacetoacetate hydrolase family protein 0.73 (0.018) YPTB2470 (acpP) YPO1600 acyl carrier protein 0.661 (0.002) YPTB2471 (fabG) YPO1599 3-oxoacyl-[acyl-carrier protein] reductase 0.573 (0.002) YPTB2561 (menF) YPO2528 menaquinone-specific isochorismate synthase 0.522 (0.011) YPTB2626 (fabB) YPO2757 3-oxoacyl-[acyl-carrier-protein] synthase I 0.605...”
- Growth of Yersinia pseudotuberculosis in human plasma: impacts on virulence and metabolic gene expression
Rosso, BMC microbiology 2008 - “...carrier protein 1.669 (0.048) YPTB2242 (acpD) YPO2323 acyl carrier protein phosphodiesterase 0.703 (0.013) YPTB2470 (acpP) YPO1600 acyl carrier protein 0.661 (0.002) YPTB2473 (fabH) YPO1597 3-oxoacyl-[acyl-carrier-protein] synthase III 0.757 (0.047) 0.708 (0.017) YPTB2626 (fabB) YPO2757 3-oxoacyl-[acyl-carrier-protein] synthase I 0.605 (0.009) YPTB2993 (lpxD) YPO1054 UDP-3-o-[3-hydroxymyristoyl] glucosamine N-acyltransferase 1.258...”
- “...YPO1972 imidazolonepropionase 0.632 (0.004) YPTB2064 YPO2082 putative fumarylacetoacetate hydrolase family protein 0.73 (0.018) YPTB2470 (acpP) YPO1600 acyl carrier protein 0.661 (0.002) YPTB2471 (fabG) YPO1599 3-oxoacyl-[acyl-carrier protein] reductase 0.573 (0.002) YPTB2561 (menF) YPO2528 menaquinone-specific isochorismate synthase 0.522 (0.011) YPTB2626 (fabB) YPO2757 3-oxoacyl-[acyl-carrier-protein] synthase I 0.605 (0.009) YPTB3258...”
D5EX68 Acyl carrier protein from Xylanibacter ruminicola (strain ATCC 19189 / DSM 19721 / CIP 105475 / JCM 8958 / 23)
61% identity, 96% coverage
B0D71_24405 acyl carrier protein from Pseudomonas laurylsulfativorans
62% identity, 100% coverage
ACP_STAA8 / Q2FZ51 Acyl carrier protein; ACP from Staphylococcus aureus (strain NCTC 8325 / PS 47) (see paper)
P0A002 Acyl carrier protein from Staphylococcus aureus (strain N315)
A7X1J8 Acyl carrier protein from Staphylococcus aureus (strain Mu3 / ATCC 700698)
SA1075 HmrB protein from Staphylococcus aureus subsp. aureus N315
SAOUHSC_01201 acyl carrier protein from Staphylococcus aureus subsp. aureus NCTC 8325
SAUSA300_1125 acyl carrier protein from Staphylococcus aureus subsp. aureus USA300_FPR3757
NWMN_1142 acyl carrier protein from Staphylococcus aureus subsp. aureus str. Newman
69% identity, 87% coverage
- function: Carrier of the growing fatty acid chain in fatty acid biosynthesis.
- Identification of N-terminal protein processing sites by chemical labeling mass spectrometry
Misal, Rapid communications in mass spectrometry : RCM 2019 - “...13 M ATISAKLVKELR K P99171 Elongation factor Ts Cytoplasm 2 2 14 M ENFDKVKDIIVDR L P0A002 Acyl carrier protein Cytoplasm 10 9 15 - MEAKAVAR T Q7A460 Ribosomal protein L22 Cytoplasm 2 2 16 M EAKAVAR T Q7A460 Ribosomal protein L22 Cytoplasm 2 2 17 M...”
- Persistent Staphylococcus aureus isolates from two independent cases of bacteremia display increased bacterial fitness and novel immune evasion phenotypes
Richards, Infection and immunity 2015 - “...binding protein 2 pbp2 0.70 0.85 0.70 1.65 A7WZT2 Enolase eno 1.75 1.75 0.15 0.10 A7X1J8 Acyl carrier protein 0.45 0.25 0.60 0.80 Q2YUM5 RNA polymerase rpoE 3.15 2.7 0.85 1.1 Q2FHT6 Thioredoxin trx 2.10 0.95 0.25 0.15 a Bold values represent significant relative changes of...”
- “...binding protein 2 pbp2 1.1 0.05 0.1 1.15 A7WZT2 Enolase eno 0.1 0.15 0.70 0.5 A7X1J8 Acyl carrier protein 0.8 0.00 0.0 0.25 Q2YUM5 RNA polymerase rpoE 0.95 0.30 0.1 0.35 Q2FHT6 Thioredoxin trx 1.1 0.00 0.45 0.45 a Bold values represent significant relative changes of...”
- Transcriptome-wide analyses of 5'-ends in RNase J mutants of a gram-positive pathogen reveal a role in RNA maturation, regulation and degradation
Linder, PLoS genetics 2014 - “...algorithm are in kcal/mol. RBS and start codon are indicated in bold. 10.1371/journal.pgen.1004207.g007 Figure 7 SA1075 mRNA inactivation by RNase J competes with translation initiation. A) Histogram showing the percentage of reads mapping to a given position, out of the total number of reads mapping to...”
- “...and J1 AGA , and appears similar to WT. B) Important positions indicated on the SA1075 gene. +1: Transcription Start Site. RBS: Ribosome Binding Site. R2 indicates the probe used for the Northern blot in panel D. C) Hairpin structure predicted by the mfold algorithm, which...”
- Direct targets of CodY in Staphylococcus aureus
Majerczyk, Journal of bacteriology 2010 - “...dehydrogenase 9.6 6.8 Purine SA1074 purK purEKCSQLFMNHD 2.7 3.3 SA1075 purC 4.9 5 SA1076 SA1077 SA1078 SA1079 SA1080 SA1081 SA0925 SA1083 purS purQ purL purF...”
- Characterizing the effects of inorganic acid and alkaline shock on the Staphylococcus aureus transcriptome and messenger RNA turnover
Anderson, FEMS immunology and medical microbiology 2010 - “...pyrophosphokinase sa_c65s61_a_at * 10.2 2.5 2.5 purA SA0018 adenylosuccinate synthetase sa_c660s471_at 4.0 2.5 ND purC SA1075 phosphoribosylaminoimidazole-succinocarboxamide synthase sa_c652s462_a_at 3.0 2.5 ND purE SA1073 phosphoribosylaminoimidazole carboxylase, catalytic subunit sa_c678s484_a_at 3.3 2.5 ND purF SA1079 amidophosphoribosyltransferase sa_c658s466_a_at 3.8 2.5 2.5 purK SA1074 phosphoribosylaminoimidazole carboxylase, ATPase subunit sa_c674s480_a_at...”
- Transcriptome and functional analysis of the eukaryotic-type serine/threonine kinase PknB in Staphylococcus aureus
Donat, Journal of bacteriology 2009 - “...1.7 1.8 1.8 1.7 1.8 Metabolism of lipids SA0224 SA0225 SA1075 SA2240 SA2334 2.6 3.1 1.5 1.5 2.0 rot prsA groEL sarR lytR hmrB mvaS Hypothetical protein, similar...”
- Characterizing the effect of the Staphylococcus aureus virulence factor regulator, SarA, on log-phase mRNA half-lives
Roberts, Journal of bacteriology 2006 - “...5 5 5 5 5 5 5 5 5 5 5 SA1075 SA1234 SA2312 SAS044 SA1305 SA2023 SA0353 SA1913 SA0182 SA0529 SA1528 Acyl carrier protein Major cold shock protein CspA D-Specific...”
- Differential gene expression profiling of Staphylococcus aureus cultivated under biofilm and planktonic conditions
Resch, Applied and environmental microbiology 2005 - “...2.59 2.575 2.52 SA0912 SA0913 SA0911 SA0910 SA0505 SA0502 SA1075 SA0842 SA2354 SA0945 4.061 3.513 3.229 3.218 3.554 3.337 3.284 3.107 2.956 2.946 SA0731 SA2204...”
- Proteomic and Metabolomic Analyses of a Tea-Tree Oil-Selected Staphylococcus aureus Small Colony Variant
Torres, Antibiotics (Basel, Switzerland) 2019 - “...acetyltransferase 2.7 SAOUHSC_01196 fapR Fatty acid biosynthesis transcriptional regulator 6.3 SAOUHSC_01197 plsX Glycerol-3-phosphate acyltransferase 2.3 SAOUHSC_01201 acpP Acyl carrier protein 2.0 SAOUHSC_01820 ackA Acetate kinase 3.2 SAOUHSC_02336 fabZ 3-Hydroxyacyl-(acyl carrier protein) dehydratase 9.1 antibiotics-08-00248-t003_Table 3 Table 3 Metabolites increased ( p 0.05) in SH1000-TTORS-1 compared to...”
- The isolation of Staphylococcus aureus tea tree oil-reduced susceptibility mutants
Cuaron, Phytotherapy research : PTR 2014 - “...-1 NCTC 8325 Locus a Function a SNP b Position Amino acid change SH1000-TTORS-1 Intragenic SAOUHSC_01201 ( acpP ) acyl carrier protein C 1151645 A 1151645 A34D SAOUHSC_01390 transposase for IS1272 C 1333141 T 1333141 H86Y Intergenic SAOUHSC_01687/SAOUHSC_01688 ( lepA ) hypothetical protein GTP-binding protein LepA...”
- Differential gene expression in Staphylococcus aureus exposed to Orange II and Sudan III azo dyes
Pan, Journal of industrial microbiology & biotechnology 2015 - “...Metabolism SAUSA300_0381 SAUSA300_0855 SAUSA300_1585 SAUSA300_2225 SAUSA300_1125 Acetyltransferase, GNAT family 0.0414 Cytoplasmic -1.56 T 0.0211 Cytoplasmic...”
- “...of carbon, nitrogen and sulfur [38, 52]. acpP (SAUSA300_1125) encodes a cytoplasmic acyl carrier protein classified into COG I or Q (corresponding to lipid...”
- Environmental fatty acids enable emergence of infectious Staphylococcus aureus resistant to FASII-targeted antimicrobials
Morvan, Nature communications 2016 - “...in BHI medium containing 10% heat-inactivated newborn calf serum and FA. The acpP gene (locus NWMN_1142) was cloned in plasmid pMalC4X (New England Biolabs) as a fusion to mbp . Briefly, acpP was PCR-amplified using forward primer 5-GCGAATTCGAAAATTTCGATAAAGTAAAAGATATC-3 and reverse primer 5-GGGAAGCTTTTATTTTTCAAGACTGTTAATAAATTTAAC-3. The digested fragment was...”
B5X54_RS06380 acyl carrier protein from Caldicellulosiruptor bescii
59% identity, 97% coverage
- Gene targets for engineering osmotolerance in Caldicellulosiruptor bescii
Sander, Biotechnology for biofuels 2020 - “...B5X54_RS06370 Malonyl CoA-acyl carrier protein transacylase 3.8 2.5 2.2 B5X54_RS06375 Beta-ketoacyl-ACP reductase 3.7 2.2 2.1 B5X54_RS06380 Acyl carrier protein 2.1 1.5 1.3 B5X54_RS06385 Beta-ketoacyl-[acyl-carrier-protein] synthase II 2.8 1.8 1.7 B5X54_RS06390 Ribonuclease III 2.2 1.3 1.3 B5X54_RS06395 Radical SAM protein 2.3 1.3 1.5 B5X54_RS07175 Methylmalonyl-CoA carboxyl transferase...”
Q88LL5 Acyl carrier protein from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
PP1915 acyl carrier protein from Pseudomonas putida KT2440
62% identity, 100% coverage
- Enhancing curcumin's solubility and antibiofilm activity via silica surface modification
Barros, Nanoscale advances 2020 - “...ATP synthase subunit alpha 8 Q88P52 Arginine deiminase 9 Q88Q10 50S ribosomal protein L21 10 Q88LL5 Acyl carrier protein 11 Q88DU1 Protein GrpE 12 Q88DU2 Chaperone protein DnaK 13 Q88QL3 30S ribosomal protein S13 14 P0A157 50S ribosomal protein L7/L12 15 Q88QN2 50S ribosomal protein L2...”
- “...Q88N55 60 kDa chaperonin 5 Q88P52 Arginine deiminase 6 Q88BX2 ATP synthase subunit alpha 7 Q88LL5 Acyl carrier protein 8 Q88NY2 Glutamate/aspartate ABC transporter-periplasmic binding protein 9 Q88QL3 30S ribosomal protein S13 10 Q88P78 Putative DNA-binding protein HU, form N 11 Q88QN9 30S ribosomal protein S7...”
- Identification of ColR binding consensus and prediction of regulon of ColRS two-component system
Kivistik, BMC molecular biology 2009 - “...that prediction of ColR regulon revealed another fatty acid and phospholipid metabolism related gene acpP (PP1915), coding for acyl carrier protein, as a putative ColR target gene, indeed, ColRS system may be involved in phospholipids homeostasis. Since ColR is highly conserved among all Pseudomonas species [...”
VC2020 acyl carrier protein from Vibrio cholerae O1 biovar eltor str. N16961
60% identity, 94% coverage
BL107_05839 acyl carrier protein from Synechococcus sp. BL107
63% identity, 94% coverage
RA0C_1243 acyl carrier protein from Riemerella anatipestifer ATCC 11845 = DSM 15868
59% identity, 95% coverage
2facA / P0A6A8 Crystal structure of e. Coli hexanoyl-acp (see paper)
61% identity, 99% coverage
- Ligand: s-(2-{[n-(2-hydroxy-4-{[hydroxy(oxido)phosphino]oxy}-3,3-dimethylbutanoyl)-beta-alanyl]amino}ethyl) hexanethioate (2facA)
HI0154 acyl carrier protein (acpP) from Haemophilus influenzae Rd KW20
P43709 Acyl carrier protein from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
NTHI0243 acyl carrier protein from Haemophilus influenzae 86-028NP
59% identity, 95% coverage
C4N14_04130 acyl carrier protein from Fusobacterium nucleatum subsp. nucleatum ATCC 23726
FN0150 Acyl carrier protein from Fusobacterium nucleatum subsp. nucleatum ATCC 25586
60% identity, 87% coverage
- A global survey of small RNA interactors identifies KhpA and KhpB as major RNA-binding proteins in Fusobacterium nucleatum
Zhu, Nucleic acids research 2024 - “...Figure S1 ). Proteins that fall into these clusters include the acyl carrier protein AcpP (C4N14_04130), which is involved in fatty acid biosynthesis and a deblocking aminopeptidase involved in carbohydrate transport and metabolism (C4N14_07180). This observation is in line with studies that identified metabolic proteins as...”
- Agarooligosaccharides as a novel concept in prebiotics: selective inhibition of <i>Ruminococcus gnavus</i> and <i>Fusobacterium nucleatum</i> while preserving Bifidobacteria, Lactobacillales <i>in vitro</i>, and inhibiting Lachnospiraceae <i>in vivo</i>
Fujii, Microbiology (Reading, England) 2024 - “...FabD, AccP and FabF in its genome (GenBank: AE009951.2), including FN0148 ( fabH ), FN0149, FN0150 and FN0151 ( fabF ). RT-qPCR analysis showed that fabF and fabH were also downregulated in F. nucleatum following AOS treatment ( Fig. 4c, d ). Fig. 4. Differential gene...”
- Proteomics of Fusobacterium nucleatum within a model developing oral microbial community
Hendrickson, MicrobiologyOpen 2014 - “...2 0 0 0 Unchanged 8 6 7 7 11 5 Covers: FN0147, FN0148, FN0149, FN0150, FN0151, FN0174, FN0408, FN0409, FN0494, FN0594, FN1850. Table 8 Phospholipid biosynthesis. FnPg versus Fn FnSg versus Fn FnPgSg versus Fn FnPgSg versus FnPg PgSg versus FnPg FnPgSg versus FnSg Total...”
2ehtA / O67611 Crystal structure of acyl carrier protein from aquifex aeolicus (form 2)
59% identity, 90% coverage
B0SDK7 Acyl carrier protein from Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
62% identity, 94% coverage
A4XJW3 Acyl carrier protein from Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
57% identity, 97% coverage
TGME49_064080, TGME49_264080 acyl carrier protein ACP from Toxoplasma gondii ME49
60% identity, 40% coverage
LIC20065 acyl carrier protein from Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130
62% identity, 94% coverage
- Global proteome analysis of Leptospira interrogans
Eshghi, Journal of proteome research 2009 - “...NS 1.196 Nucleoside-diphosphate kinase LIC13326 0.9771.042 0.8630.945 1.072 NS NS NS 1.072 Acyl carrier protein LIC20065 0.9221.39 0.6290.911 1.076 NS NS NS 1.076 Methionine adenosyl transferase LIC11354 1.1061.107 0.7080.942 1.107 NS NS NS 1.107 Ketol-acid reductoisomerase LIC13393 0.7181.557 0.60.709 1.041 0.9421.236 0.6490.804 1.209 1.125 Sugar pyridoxal-phosphate-dependent...”
2qnwA / O77470 Toxoplasma gondii apicoplast-targeted acyl carrier protein
59% identity, 94% coverage
acpP / RF|NP_440632.1 acyl carrier protein from Synechocystis sp. PCC 6803 (see 2 papers)
ssl2084 acyl carrier protein from Synechocystis sp. PCC 6803
63% identity, 94% coverage
LMOf2365_1834 acyl carrier protein from Listeria monocytogenes str. 4b F2365
lmo1806 highly similar to acyl carrier proteins from Listeria monocytogenes EGD-e
LM6179_2576 acyl carrier protein from Listeria monocytogenes 6179
62% identity, 95% coverage
- Transcriptomic Analysis of Listeria monocytogenes in Response to Bile Under Aerobic and Anaerobic Conditions
Chakravarty, Frontiers in microbiology 2021 - “...changes pH 7.5 pH 5.5 Membrane transport LMOf2365_2554 Sensor histidine kinase 4.46 12.1 Metabolism acpP LMOf2365_1834 LMOf2365_0511 Acyl carrier protein Heme oxygenase (staphylobilin-producing) 13.6 5.3 gcvT LMOf2365_1365 Glycine cleavage system T protein 8.9 4.7 LMOf2365_0585 Phosphoglycerate mutase family protein 7.7 3.6 Stress response LMOf2365_0544 Universal stress...”
- Transcriptional and phenotypic responses of Listeria monocytogenes to chlorine dioxide
Pleitner, Applied and environmental microbiology 2014 - “...and included genes encoding acyl-carrier proteins (lmo0970, lmo1806, lmo1807, lmo2202, and lmo2450) responsible for membrane lipid production (36), which...”
- “...lmo2367 Fatty acid and phospholipid metabolism lmo0970 lmo1806 lmo1807 lmo2202 lmo2450 Protein synthesis lmo0177 lmo0244 lmo0695 lmo1294 lmo1658 lmo1755 lmo2047...”
- The transcriptional response of Listeria monocytogenes during adaptation to growth on lactate and diacetate includes synergistic changes that increase fermentative acetoin production
Stasiewicz, Applied and environmental microbiology 2011 - “...lmo0225 folPB) , fatty acid metabolism genes (lmo1806, lmo1807 acpP, fabG), iron ABC transport genes (lmo1957, lmo1959), oxidative stress genes (lmo0983...”
- “...(fabZ) lmo0967 (relA), lmo2243 (adaA), lmo2662 (rpiB), lmo1806 (acpP), lmo2727 (lrp) Positive enrichment for transcription and 16 transcriptional regulators...”
- Listeria monocytogenes {sigma}B has a small core regulon and a conserved role in virulence but makes differential contributions to stress tolerance across a diverse collection of strains
Oliver, Applied and environmental microbiology 2010 - “...Berkeley lmo1696 lmo1698 lmo1702 lmo1713 lmo1749 lmo1790 lmo1806 lmo1883 lmo1929 lmo1930 lmo1931 lmo1932 lmo1933 lmo2031 lmo2033 lmo2159 lmo2160 lmo2161 lmo2162...”
- Transcriptome analysis of Listeria monocytogenes exposed to biocide stress reveals a multi-system response involving cell wall synthesis, sugar uptake, and motility
Casey, Frontiers in microbiology 2014 - “...to BZT . Functional category Locus tag Gene Protein Fold change UPREGULATED Fatty acid Biosynthesis/Metabolism LM6179_2576 acpP Acyl carrier protein 18.25 LM6179_2579 plsX Phosphate:acyl-ACP acyltransferase 4.37 LM6179_2578 fabD Malonyl CoA:acyl carrier protein transacylase 3.56 LM6179_2577 fabG Beta-ketoacyl-acyl carrier protein reductase 7.04 LM6179_2981 fabHA Beta-ketoacyl-acyl carrier protein...”
DVU1205 acyl carrier protein from Desulfovibrio vulgaris Hildenborough
59% identity, 95% coverage
PGN_1705 putative acyl carrier protein from Porphyromonas gingivalis ATCC 33277
PG1765 acyl carrier protein from Porphyromonas gingivalis W83
57% identity, 96% coverage
B7FRX6 Acyl carrier protein (Fragment) from Phaeodactylum tricornutum (strain CCAP 1055/1)
61% identity, 88% coverage
- Proteomic and biochemical responses to different concentrations of CO2 suggest the existence of multiple carbon metabolism strategies in Phaeodactylum tricornutum
Wu, Biotechnology for biofuels 2021 - “...biosynthesis (shown in Fig. 1 A), such as acetyl-CoA carboxylase (B7G7S4, B7GEB5), acetyl carrier protein (B7FRX6), malonyl CoA: ACP transacylase (B7G3D4), 3-ketoacyl-ACP synthase II (A0A1P8BJW1), 3-oxoacyl-ACP synthase (B7GCM0), 3-oxoacyl-ACP reductase (B7G1R8), enoyl-ACP reductase (B7FS72) and long chain acetyl-CoA synthase (B7FXX6 and B7FYK0), were significantly upregulated 1.27-...”
- Proteome response of Phaeodactylum tricornutum, during lipid accumulation induced by nitrogen depletion
Longworth, Algal research 2016 - “...10 1.51 B7G7H8 3R-hydroxyacyl-[acyl carrier protein] dehydrase 4 1.41 A0T0F8 Acyl carrier protein 2 1.96 B7FRX6 Acyl carrier protein 3 2.00 B7G3D4 Malonyl-CoA:ACP transacylase 2 1.41 Q2TSX2 Mitochondrial glyceraldehyde-3-phosphate dehydrogenase 2 1.53 E6Y9B3 Stearoyl-ACP desaturase 2 1.48 Fatty acid catabolism B5Y4D9 Long chain acyl-CoA synthetase 2...”
GSU1604 acyl carrier protein from Geobacter sulfurreducens PCA
62% identity, 94% coverage
- Geobacter sulfurreducens Extracellular Multiheme Cytochrome PgcA Facilitates Respiration to Fe(III) Oxides But Not Electrodes
Zacharoff, Frontiers in microbiology 2017 - “...growth complementation testing. This plasmid contains a constitutive promoter from the G. sulfurreducens gene acpP (GSU1604). GSU1761 was also cloned into the pBAD202/D-TOPO (Thermo Fisher Scientific) plasmid backbone which resulted in an arabinose inducible expression vector containing PgcA fused to a 6X histidine tag on the...”
- Scarless Genome Editing and Stable Inducible Expression Vectors for Geobacter sulfurreducens
Chan, Applied and environmental microbiology 2015 - “...GTGTCTCACGAGGGAGCAGA imcH-up-F CTGCCATCAGCTCTGTTCACC imcH-down-R CCTCTACTGTCCTGGCACGG imcH vector imcH1 ACGCCATATGACATTGCGCAAA ACCGCAG imcH2 CGCTCTAGATTGCTGCTGCAGGCCGTGTCAG pRK2-Geo1. The acpP (GSU1604) promoter region was generated by annealing and extending the primers acpP1 and acpP2 in a PCR. The product was digested with AscI and NdeI and ligated into the same sites...”
- “...and MscI and ligated into the same sites in pRK2m2 to generate pRK2m3. The acpP (GSU1604) promoter region of pRK2-Geo1 was digested with NotI and NheI and ligated into the same sites in pRK2m3 to generate pRK2-Geo2. The fragment containing the lacZ in pSRK-Km was excised...”
- Evolution of electron transfer out of the cell: comparative genomics of six Geobacter genomes
Butler, BMC genomics 2010 - “...kDa chaperonin 39998543 GSU3454 0.93 radical SAM domain protein 39995273 GSU0162 0.93 aspartate aminotransferase 39996704 GSU1604 0.93 acyl carrier protein 39995448 GSU0339 0.93 NADH dehydrogenase I, B subunit 39996890 GSU1791 0.93 ATP-dependent protease 39995447 GSU0338 0.93 NADH dehydrogenase I, A subunit 39998155 GSU3064 0.93 cell division...”
BCAL0995 acyl carrier protein (ACP) 2 from Burkholderia cenocepacia J2315
BCAL2875 acyl carrier protein (ACP) 1 from Burkholderia cenocepacia J2315
WP_004197638 acyl carrier protein from Burkholderia cenocepacia J2315
58% identity, 91% coverage
- Identification of Burkholderia cenocepacia non-coding RNAs expressed during Caenorhabditis elegans infection
Pita, Applied microbiology and biotechnology 2023 - “...code for the Hfq chaperone ( BCAL1879 ) and the acyl carrier protein AcpP ( BCAL0995 and BCAL2875 ), previously described by our research group as essential for Bcc full virulence in C. elegans (Sousa et al. 2008 , 2010 ), were found to be upregulated...”
- A decade of Burkholderia cenocepacia virulence determinant research
Loutet, Infection and immunity 2010 - “...to BCAM2762 acp ...........................................BCAL0995 and BCAL2875 (two copies) mgtC ........................................BCAM1867...”
- Identification of Burkholderia cenocepacia non-coding RNAs expressed during Caenorhabditis elegans infection
Pita, Applied microbiology and biotechnology 2023 - “...the Hfq chaperone ( BCAL1879 ) and the acyl carrier protein AcpP ( BCAL0995 and BCAL2875 ), previously described by our research group as essential for Bcc full virulence in C. elegans (Sousa et al. 2008 , 2010 ), were found to be upregulated in B....”
- A decade of Burkholderia cenocepacia virulence determinant research
Loutet, Infection and immunity 2010 - “...acp ...........................................BCAL0995 and BCAL2875 (two copies) mgtC ........................................BCAM1867 Phenylacetic acid...”
- Burkholderia cenocepacia J2315 acyl carrier protein: a potential target for antimicrobials' development?
Sousa, Microbial pathogenesis (PubMed)- GeneRIF: ACP mutants showed increased ability to form biofilms in vitro.
OA858_20585 acyl carrier protein from Pseudanabaena galeata CCNP1313
62% identity, 94% coverage
Gmet_1602 Acyl carrier protein (ACP) from Geobacter metallireducens GS-15
62% identity, 94% coverage
XF_0672 acyl carrier protein from Xylella fastidiosa 9a5c
57% identity, 94% coverage
XF0672 ACP from Xylella fastidiosa 9a5c
57% identity, 87% coverage
CV_3413 acyl carrier protein from Chromobacterium violaceum ATCC 12472
58% identity, 80% coverage
P80643 Acyl carrier protein from Bacillus subtilis (strain 168)
BSU15920 acyl carrier protein from Bacillus subtilis subsp. subtilis str. 168
58% identity, 99% coverage
- Structural and dynamic characterization of a freestanding acyl carrier protein involved in the biosynthesis of cyclic lipopeptide antibiotics
Paul, Protein science : a publication of the Protein Society 2017 - “...Streptomyces verticillus (Q9XC48), Bacillus subtilis (P80643), Escherichia coli (P0A6A8), Plasmodium falciparum (3GZM), Thermus thermophiles (Q5SL79), Lyngbya...”
- Bacteria possessing two RelA/SpoT-like proteins have evolved a specific stringent response involving the acyl carrier protein-SpoT interaction
Battesti, Journal of bacteriology 2009 - “...ACCGAATTCATGGCAGACACATTAGAGCGTG ACGCTCGAGTTATTGCTGGTTTTGTATGTAGTTC acpBsu P80643 Ebm358 Ebm359 GACTCTAGAATTCTTGCCGGGCATAGACGCC GACTCTAGATCGATCAGCTACGCAGGCGGGTG...”
- Solution structure and proposed domain domain recognition interface of an acyl carrier protein domain from a modular polyketide synthase
Alekseyev, Protein science : a publication of the Protein Society 2007 (secret) - Membrane composition and organization of Bacillus subtilis 168 and its genome-reduced derivative miniBacillus PG10
van, Microbial biotechnology 2022 - “...2.1 5.5 BSU08650 fabL Fatty acid biosynthesis 1.4 2.4 BSU36370 fabZ Fatty acid biosynthesis 4.1 BSU15920 acpA Fatty acid biosynthesis 2.9 7.5 BSU04620 acpS Fatty acid biosynthesis 3.4 BSU28560 lcfA Fatty acid degradation 1.6 1.9 BSU10270 lcfB Fatty acid degradation 4.0 3.4 BSU37170 acdA Fatty acid...”
- The Blueprint of a Minimal Cell: MiniBacillus
Reuß, Microbiology and molecular biology reviews : MMBR 2016 - “...2.7.8.7 1F80 B. subtilis acpA Aceto-acyl-Acp synthesis fabD BSU15920 Yes 1F80 B. subtilis BSU15900 Yes 2.3.1.39 3QAT Bartonella henselae BSU11330 No 2.3.1.180...”
CSUI_010330 acyl carrier protein from Cystoisospora suis
58% identity, 40% coverage
- Unravelling the sexual developmental biology of Cystoisospora suis, a model for comparative coccidian parasite studies
Cruz-Bustos, Frontiers in cellular and infection microbiology 2023 - “...CSUI_001762 Short chain dehydrogenase reductase family protein Fatty acid biosynthetic process 0.261 0.844 2.481 0.982 CSUI_010330 Acyl carrier protein Fatty acid biosynthetic process 1.514 2.756 2.079 -0.972 CSUI_002612 3-ketoacyl-(Acyl-carrier-protein) reductase Fatty acid biosynthetic process 1.263 2.319 1.543 -1.414 CSUI_003216 Short chain dehydrogenase reductase family protein Fatty...”
- “...to fuel FA synthesis. The growing fatty acyl radicals bind to the acyl carrier protein (CSUI_010330), and fatty acyl elongation involves sequential reactions by enzymes -ketoacyl-ACP synthase (CSUI_000890), -ketoacyl-ACP reductase (CSUI_002612), and enoyl-ACP reductase (CSUI_001389). The FASII pathway results in the production of short FA chains,...”
BTF1_17540 acyl carrier protein from Bacillus thuringiensis HD-789
B7HLI3 Acyl carrier protein from Bacillus cereus (strain AH187)
59% identity, 95% coverage
- NagRBt Is a Pleiotropic and Dual Transcriptional Regulator in Bacillus thuringiensis
Cao, Frontiers in microbiology 2018 - “...operon. The expression of genes, lipoprotein (BTF1_26870), acyl-dehydrogenase (BTF1_25115 and BTF1_08960), and acyl carrier protein (BTF1_17540) involved in fatty acid metabolism were decreased in the Bti75- nagR mutant, suggesting that NagR Bt could activate these genes, rather than repress them. Glucose-specific phosphotransferase enzyme IIA (BTF1_24980), phosphoenolpyruvate-protein...”
- “.../ / / 0.133 0.335 0.027 BTF1_16395 Mutt/nudix family protein / / / 0.116 NT BTF1_17540 acpP Acyl carrier protein / / / 0.206 NT BTF1_18580 nagR GntR family transcriptional regulator NagR / / / 0.0312 NT BTF1_19025 Hypothetical protein 107 aatcatctagacaact 10.1 0.0187 0.570 0.030...”
- Bacillus cereus Decreases NHE and CLO Exotoxin Synthesis to Maintain Appropriate Proteome Dynamics During Growth at Low Temperature
Duport, Toxins 2020 - “...transport and metabolism B7HS68 Lipoyl-binding domain-containing protein Cytoplasm 3.0 0.8 2.3 Lipid transport and metabolism B7HLI3 Acp Acyl carrier protein Cytoplasm 4.6 1.9 2.1 B7HX67 Lipoteichoic acid synthase Cytoplasm 1.0 3.3 6.8 B7HYD4 Glycerophosphoryl diester phosphodiesterase Cytoplasm NS 1.8 3.3 B7HUU3 NifU domain protein Cytoplasm 2.0...”
RSc1053 PROBABLE ACYL CARRIER PROTEIN from Ralstonia solanacearum GMI1000
57% identity, 91% coverage
- Of its five acyl carrier proteins, only AcpP1 functions in Ralstonia solanacearum fatty acid synthesis
Yin, Frontiers in microbiology 2022 - “...( Figure 1B ; Salanoubat et al., 2002 ). AcpP1 is encoded by the gene RSc1053 (now named acpP1 ), which occurs in the fatty acid biosynthesis gene ( fab ) cluster. AcpP2 is encoded by RSc0434 (now named acpP2 ), also located on the chromosome....”
- “...remain to be clarified. Discussion The R. solanacearum GMI1000 genome contains five open reading frames, RSc1053, RSc0434, RSp1659, RSp0370, and RSp0369, that encode putative ACPs, AcpP1, AcpP2, AcpP3, AcpP4, and AcpP5, respectively. We confirmed that these ACPs are successfully phosphopantetheinylated and identified the active site at...”
HMU05470 acyl carrier protein from Helicobacter mustelae 12198
60% identity, 87% coverage
NGK_2520 AcpP from Neisseria gonorrhoeae NCCP11945
Q5F604 Acyl carrier protein from Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
NGO1762 AcpP from Neisseria gonorrhoeae FA 1090
59% identity, 94% coverage
BP2440 acyl carrier protein from Bordetella pertussis Tohama I
56% identity, 92% coverage
B7GYR8 Acyl carrier protein from Acinetobacter baumannii (strain AB307-0294)
ABZJ_00819, WP_001279871 acyl carrier protein from Acinetobacter baumannii MDR-ZJ06
53% identity, 96% coverage
- Metagenomic and proteomic analysis of bacterial retting community and proteome profile in the degumming process of kenaf bast
Xu, BMC plant biology 2022 - “...most abundant enzymes in the retting liquids. This present results demonstrated that the expressions of B7GYR8, Q6RYW5 and Q6FFK2 proteins were suppressed in Acinetobacter with the retting time. On the contrary, P05149 was upregulated with the retting time. In Clostridium , P37698, P52040 and P54937 proteins...”
- “...and Clostridium . The protein expression profile in Acinetobacter showed that the average level of B7GYR8, Q6RYW5 and Q6FFK2 were reduced with the retting time, while P05149 was upregulated (Fig. 6 e). For proteins in Clostridium , three degumming related proteins P37698, P52040 and P54937 were...”
- Deciphering the Binding Interactions between Acinetobacter baumannii ACP and β-ketoacyl ACP Synthase III to Improve Antibiotic Targeting Using NMR Spectroscopy.
Choi, International journal of molecular sciences 2021 - GeneRIF: Deciphering the Binding Interactions between Acinetobacter baumannii ACP and beta-ketoacyl ACP Synthase III to Improve Antibiotic Targeting Using NMR Spectroscopy.
- Colistin Resistance in Acinetobacter baumannii MDR-ZJ06 Revealed by a Multiomics Approach
Hua, Frontiers in cellular and infection microbiology 2017 - “...1.09E-15 1289 384144099 ABZJ_02853 hypothetical protein 1 1 8.06 14811.21 4.39 1.58122 1.26E-18 1186 384142065 ABZJ_00819 acyl carrier protein (ACP) 21 1 10.99 10132.23 4.11 1.65109 3.70E-20 412 384142699 ABZJ_01453 hypothetical protein 14 9 46.52 25412.88 9.89 1.66497 1.81E-20 113 384144004 ABZJ_02758 beta-lactamase 268 18 55.05...”
KKC1_RS01055 acyl carrier protein from Calderihabitans maritimus
61% identity, 91% coverage
FTH_1113 acyl carrier protein from Francisella tularensis subsp. holarctica OSU18
61% identity, 63% coverage
- Multimethodological approach to identification of glycoproteins from the proteome of Francisella tularensis, an intracellular microorganism
Balonova, Journal of proteome research 2010 - “...1 - ? SPII FTH_0219 ConA, DSA, PNA, SBA 26.42 8.94 0 - ? - FTH_1113 ConA, DSA, PNA, SNA 12.89 4.28 1 EKN 18 MS cyt - FTH_0228 ConA, DSA, PNA, SNA 17.82 10.82 0 - cyt - FTH_1617 ConA, DSA, PNA, SNA 38.46 9.50...”
ACIAD0872 acyl carrier protein (ACP) from Acinetobacter sp. ADP1
52% identity, 66% coverage
2x2bA / P80643 Crystal structure of malonyl-acp (acyl carrier protein) from bacillus subtilis (see paper)
59% identity, 96% coverage
- Ligand: 3-{[2-({n-[(2s)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl]sulfanyl}-3-oxopropanoic acid (2x2bA)
HP0559 acyl carrier protein (acpP) from Helicobacter pylori 26695
57% identity, 88% coverage
- Enhanced fatty acid biosynthesis by Sigma28 in stringent responses contributes to multidrug resistance and biofilm formation in <i>Helicobacter pylori</i>
Xue, Antimicrobial agents and chemotherapy 2024 (secret) - Genomic differentiation within East Asian Helicobacter pylori
You, Microbial genomics 2022 - “...by E227R. (v) R227 interaction with a neighbouring monomer. (c) TlpD, chemotaxis receptor for HOCl. HP0559 modelled on PDB 3T9O, the regulatory CZB domain of DgcZ ( E. coli ). The flagellar filament made of flagellin FlaA (HP0601) ( Fig. 6b ), is involved in motility,...”
- A 500-year tale of co-evolution, adaptation, and virulence: Helicobacter pylori in the Americas
Muñoz-Ramirez, The ISME journal 2021 - “...Lysine-specific permease 0.3758 0.2994 5 22 HP0706 723 100.00 Membrane protein 0.3705 0.3092 3 23 HP0559 723 100.00 Acyl carrier protein 0.3693 0.3655 1 24 HP0561 723 100.00 3-oxoacyl-ACP reductase 0.3684 0.2786 3 25 HP0523 517 71.51 cag pathogenicity island protein cag4 (cagg) 0.3622 0.2806 2...”
- Structural analysis of hypothetical proteins from Helicobacter pylori: an approach to estimate functions of unknown or hypothetical proteins
Park, International journal of molecular sciences 2012 - “...but it stabilizes ACP against denaturation at alkaline pH [ 114 ]. H. pylori ACP (HP0559) is composed of 78 amino acids with a pI value of 3.9, and its primary structure is similar with those of homologous ACPs. Like other ACPs, HpACP forms a helical...”
- The pH-responsive regulon of HP0244 (FlgS), the cytoplasmic histidine kinase of Helicobacter pylori
Wen, Journal of bacteriology 2009 - “...(ppa) Fatty acid and phospholipid metabolism HP0202 HP0559 HP0370e 1.40 1.53 1.30 1.46 1.20 1.37 2.68 2.29 2.61 Beta-ketoacyl-acyl carrier protein...”
- Gene expression in vivo shows that Helicobacter pylori colonizes an acidic niche on the gastric surface
Scott, Proceedings of the National Academy of Sciences of the United States of America 2007 - “...receptor, methyl-accepting chemotaxis proteins, tlpB (HP0103) and HP0559 in the gerbil stomach but not under acidic conditions in vitro suggests that...”
- Metabolism and genetics of Helicobacter pylori: the genome era
Marais, Microbiology and molecular biology reviews : MMBR 1999 - “...and the two subunits of the holo-ACP synthase, HP0559, HP0962 (acpP), and HP0808 (acpS), respectively, are also present in the genome. The transfer reactions...”
FTL_1138 acyl carrier protein from Francisella tularensis subsp. holarctica
FTT_1376 acyl carrier protein from Francisella tularensis subsp. tularensis SCHU S4
61% identity, 76% coverage
- Further Characterization of the Capsule-Like Complex (CLC) Produced by Francisella tularensis Subspecies tularensis: Protective Efficacy and Similarity to Outer Membrane Vesicles
Champion, Frontiers in cellular and infection microbiology 2018 - “...carrier protein transacylase 62 33,480 2.30E-06 FTL_0233 S 30S ribosomal protein S7 61 17,796 2.60E-06 FTL_1138 N acyl carrier protein 61 10,653 2.30E-06 FTL_1240 S Phospho-2-dehydro-3-deoxyheptonate aldolase 60 40,853 1.80E-06 FTL_1747 S 50S ribosomal protein L1 57 24,626 4.70E-06 FTL_1275 N Dethiobiotin synthetase 55 24,487 9.70E-06...”
- Possible links between stress defense and the tricarboxylic acid (TCA) cycle in Francisella pathogenesis
Dieppedale, Molecular & cellular proteomics : MCP 2013 - “...FTL_1148 FTL_0629 FTL_0586 FTL_1866 FTL_0552 FTL_1138 FTL_1426 FTL_0068 FTL_0717 FTL_0690 FTL_0113/FTL_1159 FTL_0906 FTL_0673 FTL_0539 FTL_0427 FTL_0421...”
- Identification and characterization of novel and potent transcription promoters of Francisella tularensis
Zaide, Applied and environmental microbiology 2011 - “...bacterioferritn (Pbfr, FTL_0617), an acyl carrier protein (PacpP, FTL_1138), and a heat shock protein which belongs to the groESL operon (PgroEL, FTL_1715). The...”
- The francisella tularensis proteome and its recognition by antibodies
Kilmury, Frontiers in microbiology 2010 - “...2D-Western blot Cytoplasmic Havlasova et al. ( 2005 ), Twine et al. ( 2010 ) FTT_1376 Acyl carrier protein acpP Mouse 2D-Western blot Cytoplasmic Twine et al. ( 2006b ) FTT_1389 3-Methyl-2-oxobutanoate hydroxymethyl-transferase Mouse 2D-Western blot Unknown Twine et al. ( 2010 ) FTT_1390 Pantoate-beta-alanine ligase...”
8jfhE / Q5EDC8 Crystal structure of 3-oxoacyl-acp reductase fabg in complex with NADP+ and 3-keto-octanoyl-acp from helicobacter pylori in an inactive form that priors the acyl substrate delivery (see paper)
55% identity, 87% coverage
- Ligand: ~{s}-[2-[3-[[(2~{s})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] 3-oxidanylideneoctanethioate (8jfhE)
CA_C1747 acyl carrier protein from Clostridium acetobutylicum ATCC 824
57% identity, 87% coverage
DR_1942 acyl carrier protein from Deinococcus radiodurans R1
56% identity, 64% coverage
TC 3.D.1.6.4 / Q6UKY4 143, component of The green algal H+ translocating NADH dehydrogenase (NDH) complex (42 subunits; 33 included here) from Chlamydomonas reinhardtii (see paper)
XP_001699275 uncharacterized protein from Chlamydomonas reinhardtii
59% identity, 55% coverage
- substrates: H+
- Gains and losses of metabolic function inferred from a phylotranscriptomic analysis of algae
Goh, Scientific reports 2019 - “...(i) Chlamydomonas oxoglutarate-malate translocator (NCBI: XP_001696590);(ii) Chlamydomonas SPO11-like topoisomerase (NCBI: XP_001701722), Chlamydomonas acyl-carrier protein (NCBI: XP_001699275), and (iv) the CbbX Rubisco activase from Rhodobacter sphaeroides 9 . Supplementary Table S2 provides the full list of HMMs. HMM searches of the transcriptomes were conducted using genewisedb, part...”
- Fe-S Protein Synthesis in Green Algae Mitochondria
Gomez-Casati, Plants (Basel, Switzerland) 2021 - “...GAX75929 A0A250WTW6 GAX72625.1 (c) Chlamydomonas reinhardtii PNW80545.1 PNW87417.1 XP_001693712.1 A0A2K3D318 A0A2K3D340 A8IZ28 A8IZU0 (c) A8IK66 Q6UKY4 A0A2K3D5B5 Chlorella sorokiniana A0A2P6U3X4 PRW56423.1 A0A2P6TLS6 A0A2P6U0I2 A0A2P6TM18 A0A2P6TMK0 (c) A0A2P6TBX9 Chlorella variabilis XP_005843562.1 (c) XP_005848297.1 (c) XP_005850086.1 (c) E1ZCG7 (c) E1ZMD2 XP_005845092 (c) E1Z6T8 Chloropicon primus A0A5B8MHP9 QDZ20066.1 A0A5B8MCM2...”
A0A2J8A839 Acyl carrier protein from Tetrabaena socialis
59% identity, 55% coverage
- Fe-S Protein Synthesis in Green Algae Mitochondria
Gomez-Casati, Plants (Basel, Switzerland) 2021 - “...NREL46B-D3 KAF6244147.1 KAF6263471 KAF6260390.1 (c) Scenedesmus sp. PABB004 KAF8055824.1 KAF8065471 Tetrabaena socialis PNH03155.1 A0A2J8AFK7 A0A2J8A4Z1 A0A2J8A839 PNH09606.1 Tetradesmus obliquus A0A383VZF3 A0A383V5U1 A0A383WNF2 A0A383W6Z2 A0A383WKP1 A0A383VDA2 Trebouxia sp. A12 KAA6417420 KAA6420365 (c) KAA6425040.1 (p,m) Volvox carteri f. nagariensis XP_002951960.1 D8TNE6 D8TVN4 D8TMR1 (c) XP_002948275 D8U1A8 XP_002950872.1 (c)...”
I0YSD5 Acyl carrier protein from Coccomyxa subellipsoidea (strain C-169)
56% identity, 55% coverage
- Fe-S Protein Synthesis in Green Algae Mitochondria
Gomez-Casati, Plants (Basel, Switzerland) 2021 - “...A0A5B8MHP9 QDZ20066.1 A0A5B8MCM2 A0A5B8MHC3 QDZ23877 QDZ21836.1 Coccomyxa subellipsoidea I0Z0B3 (c) XP_005649671.1 I0YUZ0 (c) I0Z768 I0YWN6 I0YSD5 XP_005644009.1 (c) Dunaniella salina KAF5838253 KAF5839176 (c) KAF5837283.1 KAF5830450.1 KAF5832491.1 KAF5832703.1 KAF5833575.1 Gonium pectorale KXZ49215.1 A0A150GMI8 KXZ55931 (c) A0A150GAM8 KXZ42691.1 (c) Haematococcus lacustris GFH16011.1 A0A699ZQI7 GFH07090 (c) GFH14279.1 (c) Helicosporidium...”
HP0962 acyl carrier protein (acpP) from Helicobacter pylori 26695
51% identity, 46% coverage
- Delineation of the pH-Responsive Regulon Controlled by the Helicobacter pylori ArsRS Two-Component System
Loh, Infection and immunity 2021 (secret) - Differences in genome content among Helicobacter pylori isolates from patients with gastritis, duodenal ulcer, or gastric cancer reveal novel disease-associated genes
Romo-González, Infection and immunity 2009 - “...N/A, HP0744, JHP0681 N/A, HP0764, JHP0701, JHP0702 acpP, HP0962, N/A N/A, HP0963, JHP0897 N/A, HP0964, JHP0898, JHP0899 N/A, HP0965, JHP0899 N/A, HP1396,...”
- Genetic analysis of Helicobacter pylori strain populations colonizing the stomach at different times postinfection
Salama, Journal of bacteriology 2007 - “...JHP0814 No ORF Locus not present HP0880, HP0881 JHP0896 No ORF HP0962 0, 0e 0, 0 0, 0 Within clade 167, 5 108, 13 NA 189, 11 Betweens clades Polymorphisms (no....”
- Comparison of genetic divergence and fitness between two subclones of Helicobacter pylori
Björkholm, Infection and immunity 2001 - “...type II HP0882, HP0085, JHP0165, JHP0956, HP0425 HP0491 HP0962 HP1192 rpL28, rpmB acpP NA JHP0726 hsdS_4 HP1382 HP1404 HP0062, HP0338, JHP0959, HP0436, HP0450,...”
- Metabolism and genetics of Helicobacter pylori: the genome era
Marais, Microbiology and molecular biology reviews : MMBR 1999 - “...and the two subunits of the holo-ACP synthase, HP0559, HP0962 (acpP), and HP0808 (acpS), respectively, are also present in the genome. The transfer reactions of...”
WP_037276568 acyl carrier protein from Ruminococcus albus 8
52% identity, 91% coverage
FXV78_RS03245 acyl carrier protein from Mediterraneibacter gnavus ATCC 29149
55% identity, 88% coverage
RHTO_01048 acyl-carrier protein from Rhodotorula toruloides NP11
51% identity, 60% coverage
- A multi-omic map of the lipid-producing yeast Rhodosporidium toruloides
Zhu, Nature communications 2012 - “...4b , group G). The shared genes included those coding ribosomal proteins, actin, ACP ( RHTO_01048 ), TAL1 of the phosphopentose pathway, MDH1 and IDH2 of the tricarboxylic acid (TCA) cycle and GAPDH , ENO1 and FBA1 of glycolysis. Forty-two genes were highly expressed exclusively in...”
SSCH_190038 acyl carrier protein from Syntrophaceticus schinkii
53% identity, 91% coverage
- Genome-Guided Analysis and Whole Transcriptome Profiling of the Mesophilic Syntrophic Acetate Oxidising Bacterium Syntrophaceticus schinkii
Manzoor, PloS one 2016 - “...(SSCH_1110008), at least three LuxR-related transcriptional regulator (SSCH_1220017, SSCH_170030, SSCH_170036) and two acyl-carrier proteins (SSCH_1110009, SSCH_190038), which deliver acyl groups to the synthase, were found encoded in the genome. Bacteria use QS to track changes in their cell numbers and collectively alter gene expression, which enables...”
- “...putative LuxR-related transcriptional regulators (SSCH_170030, SSCH_170036) as well as both of the acyl-carrier proteins (SSCH_1110009, SSCH_190038) were found to be expressed ( S1 Fig ). A weak expression was found for the acyl-homoserine-lactone synthase LuxI (SSCH_1110008, S1 Fig ). Corresponding to the moderate growth temperatures (between...”
6lvuA / Q9WZD0 Crystal structure of apo acyl carrier protein from thermotoga maritima (see paper)
56% identity, 94% coverage
E1Z6T8 Acyl carrier protein from Chlorella variabilis
55% identity, 57% coverage
- Fe-S Protein Synthesis in Green Algae Mitochondria
Gomez-Casati, Plants (Basel, Switzerland) 2021 - “...(c) A0A2P6TBX9 Chlorella variabilis XP_005843562.1 (c) XP_005848297.1 (c) XP_005850086.1 (c) E1ZCG7 (c) E1ZMD2 XP_005845092 (c) E1Z6T8 Chloropicon primus A0A5B8MHP9 QDZ20066.1 A0A5B8MCM2 A0A5B8MHC3 QDZ23877 QDZ21836.1 Coccomyxa subellipsoidea I0Z0B3 (c) XP_005649671.1 I0YUZ0 (c) I0Z768 I0YWN6 I0YSD5 XP_005644009.1 (c) Dunaniella salina KAF5838253 KAF5839176 (c) KAF5837283.1 KAF5830450.1 KAF5832491.1 KAF5832703.1 KAF5833575.1...”
CT236 Acyl Carrier Protein from Chlamydia trachomatis D/UW-3/CX
51% identity, 90% coverage
C1N9A6 Acyl carrier protein from Micromonas pusilla (strain CCMP1545)
54% identity, 82% coverage
- Fe-S Protein Synthesis in Green Algae Mitochondria
Gomez-Casati, Plants (Basel, Switzerland) 2021 - “...XP_002502856.1 XP_002507274.1 (c) C1EHF7 C1E8J2 C1EGS6 XP_002505982.1 C1E2X1 XP_002504509.1 Micromonas pusilla XP_003055300.1 C1MZU9 C1MP69 XP_003057174 C1N9A6 XP_003059868.1 (c) Monoraphidium neglectum A0A0D2M031 (c) XP_013897551.1 XP_013898922 A0A0D2MT62 Ostreococcus lucimarinus XP_001415848.1 A4RUX0 A4RYZ0 A4RWG3 XP_001419576 A4S9X3 XP_001416215.1 Ostreococcus tauri XP_003078141.1 XP_003081355.2 XP_022838219.1 0US42676.1 Q01C69 A0A090M6V6 Q01AH9 XP_022839639 Q00SL4 XP_022840717.1...”
XP_002319260 acyl carrier protein 2, mitochondrial from Populus trichocarpa
54% identity, 55% coverage
CTL0488 acyl carrier protein from Chlamydia trachomatis 434/Bu
51% identity, 90% coverage
TC 3.D.1.6.3 / O80800 Acyl carrier protein - Arabidopsis thaliana (Mouse-ear cress)., component of The higher plant H+ translocating NADH dehydrogenase (NDH) complex (41 subunits; 23 included here) from Arabidopsis thaliana (Mouse-ear cress) (see paper)
AT1G65290 mtACP2 (mitochondrial acyl carrier protein 2); acyl carrier/ metal ion binding from Arabidopsis thaliana
53% identity, 57% coverage
- substrates: H+
- Fe-S Protein Synthesis in Green Algae Mitochondria
Gomez-Casati, Plants (Basel, Switzerland) 2021 - “...At1g65290 (mtACP2) At5g47630 (mtACP3) At4g03240 UniProt O49543-1 O49627-1 Q9LIG6-1 Q9C8J2 Q8L9E3-1 Q8GUM2 Q9LDZ0 Q8L7K4 P53665 O80800 Q9FGJ4 Q9ZR07 Identified Protein Sequences Organism Auxenochlorella protothecoides A0A087SBH3 (c) RMZ55380.1 (c) A0A087SIP0 A0A087SND2 XP_011400182 A0A087SCC7 RMZ53064.1 (c) Bathycoccus prasinos K8FF08 (p) XP_007511837.1 K8F7J7 K8F1V7 XP_007510865 K8FET8 XP_007511602.1 (p) Chlamydomonas...”
- Parthenium hysterophorus steps up Ca-regulatory pathway in defence against highlight intensities
Ahmad, Scientific reports 2020 - “...16.4/4.4 21.32/5.2 CML15 LOC_Os05g31620 88 Potential calcium sensor S23 Acyl carrier protein 2 Arabidopsis thaliana/ O80800 15.0/4.1 14.21/4.8 MTACP2 T8F5.6 26 Carrier of the elongating fatty acid chain in fatty acid biosynthesis S24 Desiccation-related protein Craterostigmaplantagineum/ P22241 15.1/6.1 16.3/5.9 62 Stress defense S25 Calmodulin-like protein 7...”
- Maternal environment alters dead pericarp biochemical properties of the desert annual plant Anastatica hierochuntica L
Khadka, PloS one 2020 - “...B AT4G38510 0.00444 5.57 Ion transport A0A1P8AXC1 FtsH extracellular protease family AT2G30950 0.0023 5.52 proteolysis O80800 Acyl carrier protein 2, mitochondrial AT1G65290 0.00262 4.91 cellular proc. Q9XGM1 V-type proton ATPase subunit D AT3G58730 0.00253 4.5 transport Q9MA79 Fructose-1,6-bisphosphatase, cytosolic AT1G43670 0.00136 4.45 response to chemical F4KGH1...”
- Estimating the nucleotide diversity in Ceratodon purpureus (Ditrichaceae) from 218 conserved exon-primed, intron-spanning nuclear loci
McDaniel, Applications in plant sciences 2013 - “...SW:RL29_RAT P25886 60S RIBOSOMAL PROTEIN L29 334 0.023392 JY262986, JY263182, JY262666 AW098361 similar to TR:O80800 O80800 T8F5.6 PROTEIN 849 0.012285 JY262903, JY263052, JY263248, JY262741 AW098364 similar to TR:O65636 O65636 HYPOTHETICAL 15.1 KD PROTEIN 442 0.004902 JY262940, JY263091, JY262776 AW098367 similar to TR:Q42809 Q42809 GMCK1P 453 0.010195...”
- The complex I subunit B22 contains a LYR domain that is crucial for an interaction with the mitochondrial acyl carrier protein SDAP1
Saha, The Plant journal : for cell and molecular biology 2025 (no snippet) - Comparative Clustering (CompaCt) of eukaryote complexomes identifies novel interactions and sheds light on protein complex evolution
van, PLoS computational biology 2023 - “...AT:5). The two Arabidopsis proteins that do not cluster with the other complex I subunits, At1g65290 and At3g08610, were both only detected in only one out of six Arabidopsis datasets, and in these data show visibly different migration than other complex I subunits. Y . lipolytica...”
- Heat stress leads to rapid lipid remodeling and transcriptional adaptations in Nicotiana tabacum pollen tubes
Krawczyk, Plant physiology 2022 - “...5.2 E 08 LOC107789890 A0A1S3ZSC9 AT5G54960 PDC2 Pyruvate decarboxylase 1.215 5.8 E 04 LOC107769281 A0A1S3XVK6 AT1G65290 MTACP1 ACP, mitochondrial 1.47 5.2 E 06 LOC107790423 A0A1S3ZU33 AT4G13050 FATA2 Acyl-ACP thioesterase A 1.17 0.0166 LOC107818291 A0A1S4CF02 AT2G34590 PDH (E1 beta) Pyruvate dehydrogenase beta subunit 1.57 1.1 E 22...”
- Transcriptomic and iTRAQ-Based Quantitative Proteomic Analyses of inap CMS in Brassica napus L
Wang, Plants (Basel, Switzerland) 2022 - “...carrier protein 1, mitochondrial 0.82 0.0247 AT2G44620 BnaC02g16510D Acyl carrier protein 2, mitochondrial 0.81 0.0217 AT1G65290 BnaC02g04760D ATP synthase subunit O, mitochondrial 0.7 0.0279 AT5G13450 BnaC04g43510D ATP synthase subunit gamma, mitochondrial 0.68 0.0232 AT2G33040 BnaC07g32820D ATP synthase subunit d, mitochondrial 0.67 0.0311 AT3G52300 BnaA03g04340D ATP synthase...”
- Fe-S Protein Synthesis in Green Algae Mitochondria
Gomez-Casati, Plants (Basel, Switzerland) 2021 - “...in Arabidopsis thaliana , there are three genes encoding mitochondrial ACPs namely mtACP1 (At2g44620), mtACP2 (At1g65290), and mtACP3 (At5g47630), and five plastidial ACPs, AtACP1 (At3g05020), AtACP2 (At1g54580), AtACP3 (At1g54630), AtACP4 (At4g25050), and AtACP5 (At5g27200) [ 40 ]. It was reported that ACP participates in the synthesis...”
- “...genes At5g65720.1 At4g22220 At3g20970 (NFU4) At1g51390 (NFU5) At5g61220 At4g37910 (HSCA1) At5g09590 (HSCA2) At5g06410 At2g44620 (mtACP1) At1g65290 (mtACP2) At5g47630 (mtACP3) At4g03240 UniProt O49543-1 O49627-1 Q9LIG6-1 Q9C8J2 Q8L9E3-1 Q8GUM2 Q9LDZ0 Q8L7K4 P53665 O80800 Q9FGJ4 Q9ZR07 Identified Protein Sequences Organism Auxenochlorella protothecoides A0A087SBH3 (c) RMZ55380.1 (c) A0A087SIP0 A0A087SND2 XP_011400182...”
- Mitochondrial Fatty Acid Synthase Utilizes Multiple Acyl Carrier Protein Isoforms
Fu, Plant physiology 2020 (PubMed) (secret) - Maternal environment alters dead pericarp biochemical properties of the desert annual plant Anastatica hierochuntica L
Khadka, PloS one 2020 - “...A0A1P8AXC1 FtsH extracellular protease family AT2G30950 0.0023 5.52 proteolysis O80800 Acyl carrier protein 2, mitochondrial AT1G65290 0.00262 4.91 cellular proc. Q9XGM1 V-type proton ATPase subunit D AT3G58730 0.00253 4.5 transport Q9MA79 Fructose-1,6-bisphosphatase, cytosolic AT1G43670 0.00136 4.45 response to chemical F4KGH1 Annexin D2. AT5G65020 0.0043 4.3 response...”
- Light Regulates the Cytokinin-Dependent Cold Stress Responses in Arabidopsis
Prerostova, Frontiers in plant science 2020 - “...C-D included an accumulation of lipid peroxidation protectant lipocalin (AT3G47860); enzymes of fatty acid biosynthesis (AT1G65290, AT5G10160); HSP70-15 protein (AT1G79920); actin-depolymerizing factor 3 (AT5G59880); and tubulin (AT5G19780). In contrast, tubulin (AT1G20010) was depleted under C-D; a decrease was found also for multiple ribosomal proteins, enzymes of...”
- More
LOC107769281 acyl carrier protein 2, mitochondrial from Nicotiana tabacum
53% identity, 56% coverage
CD1062 acyl carrier protein from Clostridium difficile 630
48% identity, 92% coverage
8e73AB / A0A1S3VXS7 8e73AB (see paper)
54% identity, 85% coverage
- Ligand: s-[2-({n-[(2s)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate (8e73AB)
Deide_05740 putative acyl carrier protein from Deinococcus deserti VCD115
51% identity, 90% coverage
R1D0Y2 Acyl carrier protein from Emiliania huxleyi
49% identity, 62% coverage
- The cellular response to ocean warming in Emiliania huxleyi
Dedman, Frontiers in microbiology 2023 - “...This is supported by a 1.67 FC reduction in abundance of the acyl carrier protein (R1D0Y2) under elevated warming compared to the control ( q 0.01) and use of isocitrate lyase to direct acetyl-CoA toward the TCA cycle. In previous work on the phytoplankton response to...”
Kole_0972 acyl carrier protein from Kosmotoga olearia TBF 19.5.1
Kole_0972 acyl carrier protein from Thermotogales bacterium TBF 19.5.1
50% identity, 92% coverage
8beeU / O80800 Cryo-em structure of the arabidopsis thaliana i+iii2 supercomplex (ci peripheral core) (see paper)
53% identity, 83% coverage
- Ligand: s-[2-({n-[(2r)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate (8beeU)
LOC110915265 acyl carrier protein 2, mitochondrial from Helianthus annuus
54% identity, 55% coverage
- Comprehensive genomics and expression analysis of eceriferum (CER) genes in sunflower (Helianthus annuus)
Muhammad, Saudi journal of biological sciences 2021 - “...458 52512.88 8.87 33 HanCER22-4 110,912,685 LOC110912685 15 10 548 63913.47 9.3 34 HanCER26-1 110,915,265 LOC110915265 16 2 132 14505.37 4.98 35 HanCER60-1 110,895,450 LOC110895450 12 3 495 55630.07 9.22 36 HanCER60-2 110,923,358 LOC110923358 17 1 471 53078.77 9.09 37 HanCER60-3 110,875,898 LOC110875898 9 2 511...”
C1E2X1 Acyl carrier protein from Micromonas commoda (strain RCC299 / NOUM17 / CCMP2709)
54% identity, 57% coverage
- Fe-S Protein Synthesis in Green Algae Mitochondria
Gomez-Casati, Plants (Basel, Switzerland) 2021 - “...PSC73872 A0A2P6VF08 Micromonas commoda XP_002506217.1 (c) XP_002501646.1 (c) XP_002502856.1 XP_002507274.1 (c) C1EHF7 C1E8J2 C1EGS6 XP_002505982.1 C1E2X1 XP_002504509.1 Micromonas pusilla XP_003055300.1 C1MZU9 C1MP69 XP_003057174 C1N9A6 XP_003059868.1 (c) Monoraphidium neglectum A0A0D2M031 (c) XP_013897551.1 XP_013898922 A0A0D2MT62 Ostreococcus lucimarinus XP_001415848.1 A4RUX0 A4RYZ0 A4RWG3 XP_001419576 A4S9X3 XP_001416215.1 Ostreococcus tauri XP_003078141.1 XP_003081355.2...”
RP763 acyl carrier protein from Rickettsia prowazekii str. Madrid E
47% identity, 93% coverage
H375_7600 acyl carrier protein from Rickettsia prowazekii str. Breinl
47% identity, 87% coverage
EBL75_16000, EBQ27_16000 acyl carrier protein from Clostridium butyricum
51% identity, 88% coverage
- Epidemiological and genetic characterization of Clostridium butyricum cultured from neonatal cases of necrotizing enterocolitis in China
Dong, Infection control and hospital epidemiology 2020 - “...al 9 2015 EBL75_04095 EBQ27_04095 Hemolysin III family protein Cassir et al 9 2015 hylA EBL75_16000 EBQ27_16000 -Hemolysin Cassir et al 9 2015 EBL75_11210 EBQ27_11215 Enterotoxin Kwok et al 23 2014 Note: indicates that there was no gene name from Genbank file. A phylogenetic tree based...”
- “...9 2015 EBL75_04095 EBQ27_04095 Hemolysin III family protein Cassir et al 9 2015 hylA EBL75_16000 EBQ27_16000 -Hemolysin Cassir et al 9 2015 EBL75_11210 EBQ27_11215 Enterotoxin Kwok et al 23 2014 Note: indicates that there was no gene name from Genbank file. A phylogenetic tree based on...”
RB318 acyl carrier protein precursor from Pirellula sp. 1
RB318 acyl carrier protein from Rhodopirellula baltica SH 1
58% identity, 96% coverage
- Life cycle analysis of the model organism Rhodopirellula baltica SH 1(T) by transcriptome studies
Wecker, Microbial biotechnology 2010 - “...recent study ( Wecker etal ., 2009 ), RB314 (together with the acyl carrier protein, RB318) was also upregulated under stressinducing conditions. The increased expression of these genes might be part of a general stress response, possibly to enhance the stability of the membrane to protect...”
- Transcriptional response of the model planctomycete Rhodopirellula baltica SH1(T) to changing environmental conditions
Wecker, BMC genomics 2009 - “...RB61 58 hypothetical protein 9.6 + RB314 309 malonyl CoA-acyl carrier protein transacylase 4.4 + RB318 81 Acyl carrier protein 3.7 + RB319 95 hypothetical protein 10.2 + fatty acid process RB767 311 conserved hypothetical protein, secreted 5.7 + RB825 117 hypothetical protein 7.8 - RB951...”
- “...oA-acyl carrier protein transacylase ( fabD - RB314), the acyl carrier protein ( acpP - RB318) and the fabB (RB320) gene - were repressed under all conditions. Interestingly, the machinery for the rearrangement and interchange of genetic material was induced under all three stressful conditions. It...”
CDR20291_1021 acyl carrier protein from Clostridium difficile R20291
CD1183 acyl carrier protein from Clostridium difficile 630
CD630_11830, CDIF630erm_01332, CDR20291_1021 acyl carrier protein from Clostridioides difficile 630
49% identity, 87% coverage
- Gut microbiota interspecies interactions shape the response of Clostridioides difficile to clinically relevant antibiotics
Hromada, PLoS biology 2023 - “...transporter, ATP-binding protein 4.46 4.0E-67 3.03 2.0E-23 CDR20291_0687 plfB formate acetyltransferase 4.38 5.0E-203 2.51 5.0E-46 CDR20291_1021 acpP acyl carrier protein 4.30 9.0E-101 2.00 9.0E-16 CDR20291_1548 none putative iron compound ABC transporter, substrate-binding protein 4.23 8.0E-117 2.77 3.0E-28 CDR20291_2437 none putative sugar transporter, substrate-binding lipoprotein 4.20 1.1E-165...”
- Biofilm regulation in Clostridioides difficile: Novel systems linked to hypervirulence
Taggart, PLoS pathogens 2021 - “...to planktonically grown cells. Gene ID Gene name Gene function/product Fold change Fatty acid biogenesis CD1183 acpP ACP 9.92 CD1062 acpP ACP 9.45 Cell wall CD2766 lcpB Ligase anchoring polysaccharide to the cell wall 24.93 CD2762 uppS Putative undecaprynyl phosphate synthetase 1.23 Exported proteins CD2831 Putative...”
- Iron Regulation in Clostridioides difficile
Berges, Frontiers in microbiology 2018 - “...protein transacylase 3.03 -0.18 3.87 0.41 CD630_11820 CDIF630erm_01331 fabG 3-oxoacyl-ACP reductase 3.65 -0.06 3.94 0.23 CD630_11830 CDIF630erm_01332 acpP Acyl carrier protein 2.95 4.28 CD630_11840 CDIF630erm_01333 fabF 3-oxoacyl-ACP synthase 2.98 0.07 4.71 0.69 01334 CRISPR/Cas and prophages CD630_29750 CDIF630erm_03259 CRISPR-associated endoribonuclease Cas2 -0.74 -2.13 CD630_29760 CDIF630erm_03260 CRISPR-associated...”
- “...transacylase 3.03 -0.18 3.87 0.41 CD630_11820 CDIF630erm_01331 fabG 3-oxoacyl-ACP reductase 3.65 -0.06 3.94 0.23 CD630_11830 CDIF630erm_01332 acpP Acyl carrier protein 2.95 4.28 CD630_11840 CDIF630erm_01333 fabF 3-oxoacyl-ACP synthase 2.98 0.07 4.71 0.69 01334 CRISPR/Cas and prophages CD630_29750 CDIF630erm_03259 CRISPR-associated endoribonuclease Cas2 -0.74 -2.13 CD630_29760 CDIF630erm_03260 CRISPR-associated endonuclease...”
O77077 Acyl carrier protein from Plasmodium falciparum
Q7KWJ1 Acyl carrier protein from Plasmodium falciparum (isolate 3D7)
PF3D7_0208500, XP_001349595 acyl carrier protein from Plasmodium falciparum 3D7
51% identity, 50% coverage
- Loading of malonyl-CoA onto tandem acyl carrier protein domains of polyunsaturated fatty acid synthases
Santín, The Journal of biological chemistry 2018 - “...P72393), ACP (Plasm) from P. falciparum (accession number O77077), and ACP (Brass) from B. napus (accession no. P17650). Identical residues are shown in white...”
- Identification of proteins targeted by the thioredoxin superfamily in Plasmodium falciparum
Sturm, PLoS pathogens 2009 - “...protein S12 O97249 PFC0295C 15.4 11 c, ++ 4.91 23 3 Acyl carrier protein, putative Q7KWJ1 PFB0385w 15.8 23 sp (api), ++ 8.87 19 3 14-3-3 protein homologue, putative Q8IB17 MAL8P1.69 29.5 34 c, +++ 4.96 20 4 Co-chaperone GrpE, putative Q8IIB6 PF11_0258 34.5 19 n,...”
- Malaria parasites require a divergent heme oxygenase for apicoplast gene expression and biogenesis
Blackwell, eLife 2024 - “...of fixed parasites indicated strong co-localization between PfHO-GFP and the apicoplast acyl carrier protein (ACP, Pf3D7_0208500; Figure 2A and Figure 2figure supplement 2 ), providing direct evidence that PfHO targets the apicoplast. Additionally, western blot analysis of parasite lysates revealed two bands by anti-GFP staining that...”
- “...data 1 . ( B ) Representative image showing PCR amplification of nuclear-encoded (apicoplast ACP: Pf3D7_0208500) and apicoplast-encoded (SufB: Pf3D7_API04700) genes from DNA co-purified with full-length PfHO-GFP, PfHO 1-83 -GFP, ACP L -PfHO 84-305 -GFP, or ACP L -GFP by GFP ChIP. Input is total parasite...”
- Formation of ER-lumenal intermediates during export of Plasmodium proteins containing transmembrane-like hydrophobic sequences
Levray, PLoS pathogens 2023 - “...and was assembled in plasmid pA827. ER-lumenal GFP 1-10 corresponds to the signal peptide from PF3D7_0208500 fused to GFP 1-10 sequence followed by a Strep-tag and the final 11 residues of PfBiP which includes the SDEL sequence (assembled in plasmid pA826). A guide RNA targeting the...”
- Divergent acyl carrier protein decouples mitochondrial Fe-S cluster biogenesis from fatty acid synthesis in malaria parasites
Falekun, eLife 2021 - GeneRIF: Divergent acyl carrier protein decouples mitochondrial Fe-S cluster biogenesis from fatty acid synthesis in malaria parasites.
- “...targeting to the apicoplast in P. falciparum , this organelle features a well-studied ACP homolog (PF3D7_0208500, aACP) that retains canonical ACP features, including the conserved Ser modified by a 4-Ppant group required for FASII function ( Shears et al., 2015 ; Gallagher and Prigge, 2010 )....”
- Novel insights from the Plasmodium falciparum sporozoite-specific proteome by probabilistic integration of 26 studies
Meerstein-Kessel, PLoS computational biology 2021 - “...with the review by Shears et al .[ 50 ], and included a protein like PF3D7_0208500, a mitochondrial acyl carrier protein that is not in the apicoplast. We thus also used the protein list of Shears et al .[ 50 ] to examine enrichment of apicoplast...”
- Divergent acyl carrier protein decouples mitochondrial Fe-S cluster biogenesis from fatty acid synthesis in malaria parasites.
Falekun, eLife 2021 - GeneRIF: Divergent acyl carrier protein decouples mitochondrial Fe-S cluster biogenesis from fatty acid synthesis in malaria parasites.
- “...targeting to the apicoplast in P. falciparum , this organelle features a well-studied ACP homolog (PF3D7_0208500, aACP) that retains canonical ACP features, including the conserved Ser modified by a 4-Ppant group required for FASII function ( Shears et al., 2015 ; Gallagher and Prigge, 2010 )....”
- An essential contractile ring protein controls cell division in Plasmodium falciparum
Rudlaff, Nature communications 2019 - “...sequence from citrate synthase (PF3D7_1022500) and to the apicoplast targeting sequence from acyl carrier protein (PF3D7_0208500) to visualize mitochondria and apicoplast formation, respectively. Organelle formation was assessed in segmented schizonts, as defined by PfGAP45 co-staining surrounding daughter cells or by micronemal PfAMA1 co-staining. Aside from the...”
- “...mCherry plasmid, pJPM29, was cloned by amplifying the leader sequence from the acyl carrier protein (PF3D7_0208500) with oJDD4320/oJDD4321 and cloning it in-frame with mCherry in a yDHODH-containing plasmid where the transgene is expressed from the Pfhsp86 promoter. PfCINCH depletion In all PfCINCH depletion assays, PfCINCH smV5-Tet...”
- Using Lipoamidase as a Novel Probe To Interrogate the Importance of Lipoylation in Plasmodium falciparum
Jhun, mBio 2018 - “...similar method, except that the first 55 amino acids of the acyl carrier protein (ACP) (PF3D7_0208500) which encode the signal peptide and apicoplast transit peptide, were amplified from the plasmid pSP002 ( 36 ) using the primers ACP 55 BamHI.F and ACP 55 BamHI.R. Ligation of...”
- Protein Degradation Systems as Antimalarial Therapeutic Targets
Ng, Trends in parasitology 2017 - “...have demonstrated punctate staining and partial co-localization with the apicoplast marker acyl carrier protein (ACP, PF3D7_0208500). In these studies, ART treatment decreased PfATG8 levels as evidenced by a decrease in intensity in immunofluorescence assays and Western blot, while the number of vesicles remained the same [...”
- More
A4S9X3 Acyl carrier protein from Ostreococcus lucimarinus (strain CCE9901)
51% identity, 62% coverage
- Fe-S Protein Synthesis in Green Algae Mitochondria
Gomez-Casati, Plants (Basel, Switzerland) 2021 - “...(c) Monoraphidium neglectum A0A0D2M031 (c) XP_013897551.1 XP_013898922 A0A0D2MT62 Ostreococcus lucimarinus XP_001415848.1 A4RUX0 A4RYZ0 A4RWG3 XP_001419576 A4S9X3 XP_001416215.1 Ostreococcus tauri XP_003078141.1 XP_003081355.2 XP_022838219.1 0US42676.1 Q01C69 A0A090M6V6 Q01AH9 XP_022839639 Q00SL4 XP_022840717.1 OUS42049.1 (c) Pycnococcus provasolii GHP08054.1 GHP08944.1 (p) Raphidocelis subcapitata A0A2V0PAY6 GBF95838.1 A0A2V0PLS6 A0A2V0PIR9 GBF88744 A0A2V0NV36 GBF91763.1 Scenedesmus...”
X276_20685 acyl carrier protein from Clostridium beijerinckii NRRL B-598
50% identity, 87% coverage
SPAC4H3.09 mitochondrial type II fatty acid synthase component from Schizosaccharomyces pombe
49% identity, 65% coverage
3gzlA / O77077 Crystal structure of holo pfacp disulfide-linked dimer (see paper)
51% identity, 84% coverage
- Ligand: 4'-phosphopantetheine (3gzlA)
PA14_40310 putative acyl carrier protein from Pseudomonas aeruginosa UCBPP-PA14
50% identity, 96% coverage
- Biofilm formation of Pseudomonas aeruginosa in spaceflight is minimized on lubricant impregnated surfaces
Flores, NPJ microgravity 2023 - “...with respect to 1-day-old biofilms. The top five DEG at day three had decreased expression (PA14_40310 [PA1869], trxB2 [PA0849], PA14_39700, PA14_10380 [PA4139], nirN [PA0509]). PA14_10380, the most differentially expressed (5.2-fold), codes for a hypothetical protein. With respect to day one, day three had increased expression of...”
- “...) with respect to 1-day-old biofilms. The top five DEG at day three correspond to: PA14_40310 (2.6-fold), malQ (3.1-fold) [PA2163], PA14_36650 (3.7-fold) [PA2159], PA14_72370 (5.1-fold) [PA5482] and pchF (3.2-fold). Again, the most differentially (under)expressed gene (PA14_72370) codes for a hypothetical protein. There was no systemic increased...”
- Evolution of biofilm-adapted gene expression profiles in lasR-deficient clinical Pseudomonas aeruginosa isolates
Jeske, NPJ biofilms and microbiomes 2022 - “...regulon. Locus Tag Gene Name Locus Tag Gene Name Locus Tag Gene Name PA14_00650 PA14_21000 PA14_40310 PA14_01490 PA14_21010 PA14_41500 PA14_01760 nuh PA14_21020 PA14_42910 PA14_02220 PA14_21030 PA14_42940 PA14_07430 PA14_26020 PA14_42950 PA14_09400 phzS PA14_30570 potF PA14_42960 PA14_09410 phzG1 PA14_30580 PA14_42970 PA14_09420 phzF1 PA14_30620 PA14_42980 PA14_09440 phzE1 PA14_30630 pqsH...”
D3YM77 Acyl carrier protein from Arachis hypogaea
48% identity, 57% coverage
M1B4L2 Acyl carrier protein from Solanum tuberosum
53% identity, 51% coverage
- Analysis of Stress Response Genes in Microtuberization of Potato <i>Solanum tuberosum</i> L.: Contributions to Osmotic and Combined Abiotic Stress Tolerance
Herrera-Isidron, Plants (Basel, Switzerland) 2024 - “...2 [ 99 ] PGSC0003DMT400060739 M1C6C4 RPL51 54S ribosomal protein L51 [ 100 ] PGSC0003DMT400036981 M1B4L2 ACP Acyl carrier protein 1 [ 101 ] plants-13-02996-t003_Table 3 Table 3 Primer set of stress resistance DEGs used to validate their expression levels. Potato ID String v11.5 ID String...”
- “...GGCCTGGAATCATCAGTTCTT GCTGCAGCTGCCTTAAATTC PGSC0003DMT400060739 M1C6C4 RPL51 XM_006346690.2 GCCGACGTTCTACTTCTTACTC TAGCTGACTACCAGCTTCCT PGSC0003DMT400007585 M0ZT85 KAS2 XM_006345186.2 GGTGGATCAGAGGCAGTAATTG CAAGGCCGAGAAGCTTTAGTAG PGSC0003DMT400036981 M1B4L2 ACP XM_006341431.2 ACATCCCGCTTTCGTGTT GTACTTTCAGGGCTGACCTTAG PGSC0003DMT400077358 M1CYA5 HSP70-8 XM_006360745.2 GCTCGTCAGAAACACGAGAA CGTGAGCCAGTTCATCACTAA...”
PBANKA_0305600 acyl carrier protein, putative from Plasmodium berghei ANKA
50% identity, 50% coverage
Cj0441 acyl carrier protein from Campylobacter jejuni subsp. jejuni NCTC 11168
47% identity, 90% coverage
- Chicken Juice Enhances C. jejuni NCTC 11168 Biofilm Formation with Distinct Morphological Features and Altered Protein Expression
Sung, Foods (Basel, Switzerland) 2024 - “...N 23.96 Cj0371 Putative flagellar motility protein - 1.70 Cj0384c kdsA 2-dehydro-3-deoxyphosphooctonate aldolase M 1.02 Cj0441 acpP Acyl carrier protein IQ 1.53 Cj0470 tuf Translation elongation factor Tu J 1.16 Cj0526c fliE Flagellar hook-basal body complex protein N 29.45 Cj0527c flgC Flagellar basal-body rod protein N...”
- Inter-Relationship Between a Transcriptional Regulator of Flagella Genes cj0440c and Thiamine Metabolic Pathway in Campylobacter jejuni
Shabbir, BioMed research international 2022 - “...this family has not been determined. This gene ( cj0440c ) is present upstream of cj0441 (which creates an acyl carrier protein, acpP) [ 9 ] and downstream of the cj0437 - cj0439 operon, which plays a pivotal role in the susceptibility of Campylobacter to hydrogen...”
- The Involvement of the Cas9 Gene in Virulence of Campylobacter jejuni
Shabbir, Frontiers in cellular and infection microbiology 2018 - “...genes involved in chemotaxis were also found to be down-regulated. Several genes, such as Cj0535, Cj0441 , and Cj1299 that play a role in energy metabolism were also found to be down-regulated. Five genes ( Cj0330c, Cj0664c, Cj0471, Cj1708c , and Cj1694c ) encoding ribosomal proteins...”
- “...0.327 Cj0440c Transcriptional regulator 1.35 0.0039 0.164 Cj0535 2-oxoglutarate-acceptor oxidoreductase subunit (OorD) 1.28 0.0069 0.223 Cj0441 Acyl carrier protein carries the fatty acid chain in fatty acid biosynthesis (acpP) 1.22 0.0024 0.134 Cj1299 Acyl carrier protein (acpP2) 1.11 0.0205 0.429 Cj0330c 50S ribosomal protein L32 (rpmF)...”
- Cj0440c Affects Flagella Formation and In Vivo Colonization of Erythromycin-Susceptible and -Resistant Campylobacter jejuni
Hao, Frontiers in microbiology 2017 - “...2000 ; Weingarten et al., 2009 ; Kassem et al., 2012 ) and upstream of Cj0441 ( acpP , acyl carrier protein) which is a universal and highly conserved acyl donor for synthesis of fatty acid, endotoxin and acylated homoserine lactones for the quorum sensing in...”
- Transcriptional regulation of the CmeABC multidrug efflux pump and the KatA catalase by CosR in Campylobacter jejuni
Hwang, Journal of bacteriology 2012 - “...Cj0436 acpP fabF accA Cj0955c Cj0436 Cj0441 Cj0442 Cj0443 Putative histidine triad (HIT) family protein Bifunctional phosphoribosylaminoimidazolecarboxamide...”
- AI-2 does not function as a quorum sensing molecule in Campylobacter jejuni during exponential growth in vitro
Holmes, BMC microbiology 2009 - “...Cj0439 [ sdhC ], Cj1364 [ fumC ]), fatty acid biosynthesis (Cj0116 [ fabD ], Cj0441 [ acpP ], Cj1400 [ fabI ]), and amino acid biosynthesis (Cj0346 [ trpD ], Cj0347 [ trpF ], Cj0348 [ trpB ], Cj0349 [ trpA ], Cj0405 [ aroE...”
PA1869 probable acyl carrier protein from Pseudomonas aeruginosa PAO1
NP_250560 acyl carrier protein from Pseudomonas aeruginosa PAO1
O52658 Acyl carrier protein 2 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
49% identity, 96% coverage
- The relationship between <i>pqs</i> gene expression and acylhomoserine lactone signaling in <i>Pseudomonas aeruginosa</i>
Soto-Aceves, Journal of bacteriology 2024 (secret) - Distinct transcriptome and traits of freshly dispersed <i>Pseudomonas aeruginosa</i> cells
Kalia, mSphere 2024 - “...regulator LasR Downregulated 0.35513 Downregulated 0.42317 PA1804 DNA binding protein HU Downregulated 0.48589 Downregulated 0.7316 PA1869 Acp1 Downregulated 0.82325 Downregulated 1.13489 PA3623 Conserved hypothetical protein Downregulated 0.75899 Downregulated 0.6439 PA3808 Conserved hypothetical protein Downregulated 0.44342 Downregulated 0.86057 PA4408 Cell division protein FtsA Downregulated 0.51826 Downregulated 0.96422...”
- Backbone <sup>1</sup>H, <sup>13</sup>C and <sup>15</sup>N assignments of the apo-acyl carrier protein (ACP<sub>1</sub>) of Pseudomonas aeruginosa
Rizzo, Biomolecular NMR assignments 2023 - “...study, we specifically labeled the ACP 1 ( P. aeruginosa PAO1 in open reading frame PA1869) backbone with 15 N, 13 C nuclei and conducted a suite of triple resonance experiments to assign backbone resonances for each amino acid in this protein. These efforts should facilitate...”
- “...acid sequence alignment of the ACPs found in Pseudomonas aeruginosa . The open reading frames PA1869, PA2966, PA3334 code for ACP 1 , ACP 2 (ACP P ) and ACP 3 respectively. Conservation is shown in shades of blue, with darker blue indicating the sequence identity....”
- A VirB4 ATPase of the mobile accessory genome orchestrates core genome-encoded features of physiology, metabolism, and virulence of Pseudomonas aeruginosa TBCF10839
Wiehlmann, Frontiers in cellular and infection microbiology 2023 - “...PA1671 stk1, serine-threonine kinase Stk1 29.3 PA1738 Probable transcriptional regulator 8.0 PA1739 Probable oxidoreductase 8.0 PA1869 Probable acyl carrier protein 60.8 PA1876 Probable ATP-binding/permease fusion ABC transporter 8.8 PA1881 Probable oxidoreductase 6.8 PA1891 Hypothetical protein 8.3 PA1892 Hypothetical protein 10.6 PA1894 Hypothetical protein 14.5 PA1897 Hypothetical...”
- Genetic and Transcriptomic Characteristics of RhlR-Dependent Quorum Sensing in Cystic Fibrosis Isolates of Pseudomonas aeruginosa
Asfahl, mSystems 2022 - “...fold change E104 E113 E125 E131 E167 PA1221 Hypothetical protein 5.19 20.07 2.71 4.03 5.78 PA1869 Probable acyl carrier protein 28.72 79.34 5.78 14.77 10.05 PA2193 hcnA Hydrogen cyanide synthase HcnA 23.85 65.55 9.66 8.91 39.16 PA2194 hcnB Hydrogen cyanide synthase HcnB 8.19 8.61 2.35 2.92...”
- Traditional Chinese Medicine Tanreqing Inhibits Quorum Sensing Systems in Pseudomonas aeruginosa
Yang, Frontiers in microbiology 2020 - “...PA1784 1.2 1.6 + Hypothetical protein PA1837 2 Hypothetical protein PA1838 cysI 1.5 Sulfite reductase PA1869 acp1 2.4 2.2 + Acp1 PA1871 lasA 2 3.4 + LasA protease precursor PA1899 phzA2 2.1 2.8 Probable phenazine biosynthesis protein PA1900 phzB2 3.2 5.6 Probable phenazine biosynthesis protein PA1901...”
- A rhlI 5' UTR-Derived sRNA Regulates RhlR-Dependent Quorum Sensing in Pseudomonas aeruginosa
Thomason, mBio 2019 - “...these sRNAs, designated SPA0034 ( 28 ), is located downstream of a known QS-activated gene, PA1869 ( 5 ) ( Fig.1D ), and might be a 3 UTR-derived sRNA similar to those identified in other bacterial species ( 29 32 ). Notably, we identified a premature...”
- Acyl Carrier Protein 3 Is Involved in Oxidative Stress Response in Pseudomonas aeruginosa
Chen, Frontiers in microbiology 2018 - “...The P. aeruginosa genome contains three putative acp genes, annotated as PA2966 ( acpP ), PA1869 ( acp1 ), and PA3334 ( acp3 ). Each contains a conserved serine that is presumed to be the site of 4-phosphopantetheinylation ( Raychaudhuri et al., 2005 ). Recently, AcpP...”
- More
- Structures of Pseudomonas aeruginosa β-ketoacyl-(acyl-carrier-protein) synthase II (FabF) and a C164Q mutant provide templates for antibacterial drug discovery and identify a buried potassium ion and a ligand-binding site that is an artefact of the crystal form.
Baum, Acta crystallographica. Section F, Structural biology communications 2015 - GeneRIF: Structures of Pseudomonas aeruginosa beta-ketoacyl-(acyl-carrier-protein) synthase II (FabF) and a C164Q mutant provide templates for antibacterial drug discovery and identify a buried potassium ion and a ligand-binding site.
- Identification, Culture Characteristics and Whole-Genome Analysis of Pestalotiopsis neglecta Causing Black Spot Blight of Pinus sylvestris var. mongolica
Yang, Journal of fungi (Basel, Switzerland) 2023 - “...maculans Unknown 41.2 gene12442 Scaffold7 PHI:9526 A0A384JQ57 Botrytis cinerea Pectin esterase 47.6 gene12718 Scaffold7 PHI:8556 O52658 Pseudomonas aeruginosa Acyl carrier protein 37.8 gene13268 Scaffold7 PHI:6090 A0A0R1BRS8 Acinetobacter nosocomialis Hydroperoxidase 45.8 gene13405 Scaffold7 PHI:2393 I1R980 Fusarium graminearum - 34.5 gene13409 Scaffold7 PHI:2393 I1R980 Fusarium graminearum - 24.2...”
- Bacteria possessing two RelA/SpoT-like proteins have evolved a specific stringent response involving the acyl carrier protein-SpoT interaction
Battesti, Journal of bacteriology 2009 - “...ACCGATCGATAAGCTTCAGGTCGGCACGGCTTCC acp2Pae O52658 Ebm346 Ebm347 CACCGAATTCATGGCAGTATTTGAAAAAGTAC ACCGCTCGAGTTATTTTGCTTGCTCTTCAACGTAAG...”
Q10LF1 Acyl carrier protein from Oryza sativa subsp. japonica
51% identity, 53% coverage
B7FRC2 Acyl carrier protein from Phaeodactylum tricornutum (strain CCAP 1055/1)
46% identity, 57% coverage
K8FET8 Acyl carrier protein from Bathycoccus prasinos
49% identity, 56% coverage
- Fe-S Protein Synthesis in Green Algae Mitochondria
Gomez-Casati, Plants (Basel, Switzerland) 2021 - “...(c) A0A087SIP0 A0A087SND2 XP_011400182 A0A087SCC7 RMZ53064.1 (c) Bathycoccus prasinos K8FF08 (p) XP_007511837.1 K8F7J7 K8F1V7 XP_007510865 K8FET8 XP_007511602.1 (p) Chlamydomonas eustigma GAX73632.1 A0A250XNZ5 A0A250XIU3 GAX75929 A0A250WTW6 GAX72625.1 (c) Chlamydomonas reinhardtii PNW80545.1 PNW87417.1 XP_001693712.1 A0A2K3D318 A0A2K3D340 A8IZ28 A8IZU0 (c) A8IK66 Q6UKY4 A0A2K3D5B5 Chlorella sorokiniana A0A2P6U3X4 PRW56423.1 A0A2P6TLS6 A0A2P6U0I2...”
Q00SL4 Acyl carrier protein from Ostreococcus tauri
61% identity, 48% coverage
- Fe-S Protein Synthesis in Green Algae Mitochondria
Gomez-Casati, Plants (Basel, Switzerland) 2021 - “...A4RYZ0 A4RWG3 XP_001419576 A4S9X3 XP_001416215.1 Ostreococcus tauri XP_003078141.1 XP_003081355.2 XP_022838219.1 0US42676.1 Q01C69 A0A090M6V6 Q01AH9 XP_022839639 Q00SL4 XP_022840717.1 OUS42049.1 (c) Pycnococcus provasolii GHP08054.1 GHP08944.1 (p) Raphidocelis subcapitata A0A2V0PAY6 GBF95838.1 A0A2V0PLS6 A0A2V0PIR9 GBF88744 A0A2V0NV36 GBF91763.1 Scenedesmus sp. NREL46B-D3 KAF6244147.1 KAF6263471 KAF6260390.1 (c) Scenedesmus sp. PABB004 KAF8055824.1 KAF8065471 Tetrabaena...”
7zmbQ / G0SBG9 Cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 2) (see paper)
48% identity, 84% coverage
- Ligand: s-[2-({n-[(2s)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate (7zmbQ)
A0T0F8 Acyl carrier protein from Phaeodactylum tricornutum (strain CCAP 1055/1)
48% identity, 96% coverage
D8IBL1 Acyl carrier protein from Brachyspira pilosicoli (strain ATCC BAA-1826 / 95/1000)
J9USC6 Acyl carrier protein from Brachyspira pilosicoli B2904
K0JK36 Acyl carrier protein from Brachyspira pilosicoli WesB
Q6VAN3 Acyl carrier protein from Brachyspira pilosicoli
BP951000_0533 acyl carrier protein from Brachyspira pilosicoli 95/1000
44% identity, 86% coverage
- The Exposed Proteomes of Brachyspira hyodysenteriae and B. pilosicoli
Casas, Frontiers in microbiology 2016 - “...0 ALIDEIKDVVANQLNISDK 0 113 63 2 548 188 Acyl carrier protein A0A097BU34 ; C0QYL1 ; D8IBL1 ; J9USC6 ; K0JK36 ; O34163 ; Q6VAN3 C FFEVRVESY 8 2 0 629 202 36 Rubrerythrin D8ICG1 ; J9UBZ5 ; K0JKT4 BRAPL KFFEVRVESY 0 1 0 79 68 49...”
- The Exposed Proteomes of Brachyspira hyodysenteriae and B. pilosicoli
Casas, Frontiers in microbiology 2016 - “...0 113 63 2 548 188 Acyl carrier protein A0A097BU34 ; C0QYL1 ; D8IBL1 ; J9USC6 ; K0JK36 ; O34163 ; Q6VAN3 C FFEVRVESY 8 2 0 629 202 36 Rubrerythrin D8ICG1 ; J9UBZ5 ; K0JKT4 BRAPL KFFEVRVESY 0 1 0 79 68 49 FEVRVESY 0...”
- The Exposed Proteomes of Brachyspira hyodysenteriae and B. pilosicoli
Casas, Frontiers in microbiology 2016 - “...63 2 548 188 Acyl carrier protein A0A097BU34 ; C0QYL1 ; D8IBL1 ; J9USC6 ; K0JK36 ; O34163 ; Q6VAN3 C FFEVRVESY 8 2 0 629 202 36 Rubrerythrin D8ICG1 ; J9UBZ5 ; K0JKT4 BRAPL KFFEVRVESY 0 1 0 79 68 49 FEVRVESY 0 0 0...”
- The Exposed Proteomes of Brachyspira hyodysenteriae and B. pilosicoli
Casas, Frontiers in microbiology 2016 - “...Acyl carrier protein A0A097BU34 ; C0QYL1 ; D8IBL1 ; J9USC6 ; K0JK36 ; O34163 ; Q6VAN3 C FFEVRVESY 8 2 0 629 202 36 Rubrerythrin D8ICG1 ; J9UBZ5 ; K0JKT4 BRAPL KFFEVRVESY 0 1 0 79 68 49 FEVRVESY 0 0 0 146 40 0 AIIAEVFEEFASLSGR...”
- The complete genome sequence of the pathogenic intestinal spirochete Brachyspira pilosicoli and comparison with other Brachyspira genomes
Wanchanthuek, PloS one 2010 - “...protein ( hly , BP951000_0473), acyl carrier protein: contains beta-hemolysin ( acpP or hylA , BP951000_0533), putative hemolysin III (BP951000_0424), and putative channel protein hemolysin III family protein (BP951000_0888). The eighth was a putative hemolysin (BP951000_2207) that was similar to a protein of Parabacteroides distasonis ATCC...”
- “...locus comprising ACP synthase II ( fabF , BP951000_0532), acyl carrier protein ( acpP , BP951000_0533) and acyl reductase ( fabG , BP951000_0534) being identified while FabZ provides the 3-hydroxymyristate moieties characteristic of lipid A. FabD is involved in elongation reactions in fatty acid synthesis. These...”
HCBG_02433 acyl carrier protein from Histoplasma capsulatum G186AR
55% identity, 38% coverage
- Extracellular Vesicle-Mediated RNA Release in Histoplasma capsulatum
Alves, mSphere 2019 - “...3NS Class V chitinase Catabolic process HCBG_06620 3R 3R Transaldolase Carbohydrate metabolic process Lipid metabolism HCBG_02433 MF 5F Acyl carrier protein Biosynthetic process HCBG_01540 MF MF Predicted protein Lipid metabolic process HCBG_04372 3R GPI anchor biosynthesis protein (Pig-f) Lipid metabolic process Response to stress HCBG_02224 3F...”
darC / AAN18033.1 acyl carrier protein from Pseudomonas chlororaphis subsp. aurantiaca (see paper)
42% identity, 89% coverage
TC 3.D.1.6.2 / P11943 9.6, component of The fungal H+ translocating NADH dehydrogenase (NDH) complex (38 subunits; 35 included here) from Neurospora crassa (see 4 papers)
58% identity, 41% coverage
- substrates: H+
tcdb comment: The high resolution (3.6 - 3.9 Å) structure of the mitochondrial Yarrowia lipolytica enzyme, showing all central subunits that execute the bioenergetic functions, has been solved (see discussion for TC# 3.A.1 and Zickermann et al. 2015)
plu2165 No description from Photorhabdus luminescens subsp. laumondii TTO1
42% identity, 91% coverage
XP_843682 acyl carrier protein, mitochondrial precursor, putative from Trypanosoma brucei brucei TREU927
Q57WW9 Acyl carrier protein from Trypanosoma brucei brucei (strain 927/4 GUTat10.1)
44% identity, 49% coverage
ACP_BRAHO / O34163 Acyl carrier protein; ACP from Brachyspira hyodysenteriae (Treponema hyodysenteriae) (see paper)
BHWA1_02643 acyl carrier protein (ACP) Contains: Beta-hemolysin from Brachyspira hyodysenteriae WA1
C0QYL1 Acyl carrier protein from Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
44% identity, 86% coverage
B6UHG1 Acyl carrier protein from Zea mays
45% identity, 53% coverage
- Comparative proteomic analysis reveals that exogenous 6-benzyladenine (6-BA) improves the defense system activity of waterlogged summer maize
Hu, BMC plant biology 2020 - “...Lipoxygenase (Q9LKL4). In addition, proteins involved in fatty acid metabolism such as Acyl carrier protein (B6UHG1, B6SJF5, B4FDG2), Diphosphonucleotide phosphatase1 (C0PES7) and Triglyceride lipases (A0A1D6JA03) were up-accumulated in V36, but down-accumulated in V36-B. However, Fatty acid desaturase8 were down-regulated in V36 and V36-B (Table 2 ;...”
- “...protein OS=Zea mays GN=ZEAMMB73_Zm00001d032019 7 8.4 1 1 1 1.96 2.4E-06 0.72 0.000344 0.37 0.0000025 B6UHG1 Acyl carrier protein OS=Zea mays GN=ZEAMMB73_Zm00001d019186 7 6.8 1 3 1 1.37 0.00112 0.86 0.0269 0.63 0.000222 C0PES7 Diphosphonucleotide phosphatase1 OS=Zea mays GN=ZEAMMB73_Zm00001d023698 186 30.7 10 21 10 1.34 4.5E-06...”
TP0808 acyl carrier protein (acpP) from Treponema pallidum subsp. pallidum str. Nichols
46% identity, 95% coverage
A4HFE7 Acyl carrier protein from Leishmania braziliensis
44% identity, 48% coverage
XP_814961 acyl carrier protein, mitochondrial precursor, putative from Trypanosoma cruzi
44% identity, 43% coverage
- Subcellular proteomics of Trypanosoma cruzi reservosomes
Sant'Anna, Proteomics 2009 - “...Y (3) 114 RNA-binding protein 2 XP_818766 Mitochondrial RNA binding N 115 Acyl carrier protein XP_814961 Fatty acid biosynthetic process N 116 Oligo_U binding protein TBRGG1 XP_809536 N 117 ATP synthase, epsilon chain XP_818987 Proton-transporting ATP synthase complex N 118 Chaperonin HSP60/CNP60 XP_804030 Protein import into...”
XP_003721835 putative acyl carrier protein from Leishmania major strain Friedlin
46% identity, 48% coverage
E1C4C0 Acyl carrier protein from Gallus gallus
42% identity, 49% coverage
E9BIW4 Acyl carrier protein from Leishmania donovani
44% identity, 48% coverage
A4I2L8 Acyl carrier protein from Leishmania infantum
44% identity, 48% coverage
LOC18599903 acyl carrier protein 1, chloroplastic from Theobroma cacao
50% identity, 51% coverage
- Identification of a Novel Polerovirus in Cocoa (Theobroma cacao) Germplasm and Development of Molecular Methods for Use in Diagnostics
Ullah, Pathogens (Basel, Switzerland) 2023 - “...P5 proteins in the identified contig. The T. cacao acyl carrier protein 1 gene (ACP1; LOC18599903) was selected as the internal control (IC), as it constitutively expresses across the various cacao tissues [ 27 ]. A primer set was designed from exon two and three of...”
- “...ACP1_Exon3 ACP_R CACATACCTTATCCACAGTCTCT 17541776 ** 629 * Size from mRNA (XM_007030091.2); ** Size from gene (LOC18599903). pathogens-12-01284-t002_Table 2 Table 2 List of the RNA-Seq datasets in BioProject PRJNA558793 that contained a significant number of reads mapped to partial cacao polerovirus sequences. Regular and italic font styles...”
- Bioinformatic, genetic and molecular analysis of several badnavirus sequences integrated in the genomes of diverse cocoa (Theobroma cacao L.) germplasm
Ullah, Saudi journal of biological sciences 2023 - “...PAP26 F PAP26 R Host right border Host left border AACACCTCCAGAGATTGGTCC ACAAGACAGTCTGTGCTCCAC 60 125 TcACP1 LOC18599903 ACP1 F ACP1 R Left primer Right primer CAGCGAGAAAAGTGCCTAGA AAATAAATAGACTTGAGTTCACAACAA 60 128 *expected size without viral insertion. **expected size with viral insertion. 2.5 Sequence analysis and phylogeny The sequences of...”
- “...accession LOC18601928) and eTcBV1-II ( TcPAP26 ; GenBank accession LOC18588841) and the reference gene ACP1 (LOC18599903) using Primer Blast tool ( https://www.ncbi.nlm.nih.gov/tools/primer-blast ). StepOnePlus Real-Time PCR system was used for real time RT-PCR. PowerUp SYBR Green master mix (Applied Biosystems, UK) was used in qRT-PCR. The...”
Q9FGJ4 Acyl carrier protein 3, mitochondrial from Arabidopsis thaliana
AT5G47630 mtACP3 (mitochondrial acyl carrier protein 3); acyl carrier/ cofactor binding from Arabidopsis thaliana
46% identity, 53% coverage
- Fe-S Protein Synthesis in Green Algae Mitochondria
Gomez-Casati, Plants (Basel, Switzerland) 2021 - “...(mtACP2) At5g47630 (mtACP3) At4g03240 UniProt O49543-1 O49627-1 Q9LIG6-1 Q9C8J2 Q8L9E3-1 Q8GUM2 Q9LDZ0 Q8L7K4 P53665 O80800 Q9FGJ4 Q9ZR07 Identified Protein Sequences Organism Auxenochlorella protothecoides A0A087SBH3 (c) RMZ55380.1 (c) A0A087SIP0 A0A087SND2 XP_011400182 A0A087SCC7 RMZ53064.1 (c) Bathycoccus prasinos K8FF08 (p) XP_007511837.1 K8F7J7 K8F1V7 XP_007510865 K8FET8 XP_007511602.1 (p) Chlamydomonas eustigma...”
- The complex I subunit B22 contains a LYR domain that is crucial for an interaction with the mitochondrial acyl carrier protein SDAP1
Saha, The Plant journal : for cell and molecular biology 2025 (no snippet) - Fe-S Protein Synthesis in Green Algae Mitochondria
Gomez-Casati, Plants (Basel, Switzerland) 2021 - “..., there are three genes encoding mitochondrial ACPs namely mtACP1 (At2g44620), mtACP2 (At1g65290), and mtACP3 (At5g47630), and five plastidial ACPs, AtACP1 (At3g05020), AtACP2 (At1g54580), AtACP3 (At1g54630), AtACP4 (At4g25050), and AtACP5 (At5g27200) [ 40 ]. It was reported that ACP participates in the synthesis of fatty acids...”
- “...At4g22220 At3g20970 (NFU4) At1g51390 (NFU5) At5g61220 At4g37910 (HSCA1) At5g09590 (HSCA2) At5g06410 At2g44620 (mtACP1) At1g65290 (mtACP2) At5g47630 (mtACP3) At4g03240 UniProt O49543-1 O49627-1 Q9LIG6-1 Q9C8J2 Q8L9E3-1 Q8GUM2 Q9LDZ0 Q8L7K4 P53665 O80800 Q9FGJ4 Q9ZR07 Identified Protein Sequences Organism Auxenochlorella protothecoides A0A087SBH3 (c) RMZ55380.1 (c) A0A087SIP0 A0A087SND2 XP_011400182 A0A087SCC7 RMZ53064.1...”
- Mitochondrial Fatty Acid Synthase Utilizes Multiple Acyl Carrier Protein Isoforms
Fu, Plant physiology 2020 (PubMed) (secret) - Genes of ACYL CARRIER PROTEIN Family Show Different Expression Profiles and Overexpression of ACYL CARRIER PROTEIN 5 Modulates Fatty Acid Composition and Enhances Salt Stress Tolerance in Arabidopsis
Huang, Frontiers in plant science 2017 - “...Arabidopsis thaliana harbors three genes encoding mitochondrial ACPs, namely mtACP1 (At2g44620), mtACP2 (At1g65290), and mtACP3 (At5g47630), and five plastidial ACPs, AtACP1 (At3g05020), AtACP2 (At1g54580), AtACP3 (At1g54630), AtACP4 (At4g25050), and AtACP5 (At5g27200) ( Meyer et al., 2007 ). Based on protein analysis, AtACP1 , AtACP2 , and...”
- Identification of cleavage sites and substrate proteins for two mitochondrial intermediate peptidases in Arabidopsis thaliana
Carrie, Journal of experimental botany 2015 - “...AT4G37910 Hsp70-1 FC FCSRPVGNDVIGIDLGTTNSCVSVMEGKTAR SRPVGNDVIGIDLGTTNSCVSVMEGKTAR 18 AT5G09450 Pentatricopeptide repeat (PPR) protein YN YNADAAIGNSLVEESEEKDDLKSR ADAAIGNSLVEESEEKDDLKSR 19 AT5G47630 Mitochondrial acyl carrier protein 3 FT FTSEAAADGGQDQILSR SEAAADGGQDQILSR 20 AT5G50850 Transketolase family protein Y YAAGAKEMTVR AAGAKEMTVR 21 AT5G55070 Dihydrolipoamide succinyltransferase F FSSDSGDVVEAVVPHMGESITDGTLAAFLKKPGDR SSDSGDVVEAVVPHMGESITDGTLAAFLKKPGDR 22 AT4G08390 Ascorbate peroxidase FN FNSTTAATKSSSSDPDQLKNAR STTAATKSSSSDPDQLKNAR...”
- “...be able to cleave some proteins twice. For example, the mitochondrial acyl carrier protein 3 (At5g47630) had three different N-termini identified: 38 FTSEAAADGGQDQILSR 54 , upregulated 100-fold in icp55 mitochondria; 39 TSEAAADGGQDQILSR 54 , downregulated 10-fold in icp55 mitochondria; and 40 SEAAADGGQDQILSR 54 , downregulated 100-fold...”
- Proteomic investigations of complex I composition: how to define a subunit?
Meyer, Frontiers in plant science 2012 - “...B9 subunit At5g08050 B14.5a subunit At4g34700 B22 subunit X $ At3g29970 MLQR subunit At1g65290, At2g44620, At5g47630 SDAP subunit NON-CONSERVED BOVINE COMPLEX I 10kDa subunit B17 subunit From six proteomic analyses of Arabidopsis complex I, 49 different proteins were identified (the identification is indicated with X). From...”
- Conservation and divergence of microRNAs in Populus
Barakat, BMC genomics 2007 - “...At4g23740 Kinase protein Gw1.X.2191.1 At3g12530 DNA replication protein Psf2 ptr-miR7024 EstExt_fgenesh4_pg.C_LG_IX0044 At1g76310 B-like cyclin EstExt_fgenesh4_pg.C_LG_XVI0015 At5g47630 Acyl carrier family protein (ACP) Grail3.0083002901 At5g49980 F-box ptr-miR7025 DN496261 At3g19830 C2 domain-containing protein ptr-miR7032 TA4511_293756 At3g05560.1 60S ribosomal protein ptr-miR7033-1 Fgenesh4_pg.C_LG_III000186 At5g57010 Calmodulin-binding family protein ptr-miR7033-2 Fgenesh4_pg.C_LG_III000186 At5g57010 Calmodulin-binding...”
Q6C7X2 Acyl carrier protein from Yarrowia lipolytica (strain CLIB 122 / E 150)
52% identity, 45% coverage
8ba0U / Q94519 Drosophila melanogaster complex i in the twisted state (dm2) (see paper)
44% identity, 82% coverage
- Ligand: ~{s}-[2-[3-[[(2~{r})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{s})-3-oxidanyltetradecanethioate (8ba0U)
7ar7T / P53665 Cryo-em structure of arabidopsis thaliana complex-i (open conformation) (see paper)
47% identity, 83% coverage
- Ligand: s-[2-({n-[(2r)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate (7ar7T)
AAB96840.1 acyl carrier protein precursor from Arabidopsis thaliana (see paper)
P53665 Acyl carrier protein 1, mitochondrial from Arabidopsis thaliana
AT2G44620 MTACP-1 (MITOCHONDRIAL ACYL CARRIER PROTEIN 1); acyl carrier/ cofactor binding / phosphopantetheine binding from Arabidopsis thaliana
47% identity, 57% coverage
- Fe-S Protein Synthesis in Green Algae Mitochondria
Gomez-Casati, Plants (Basel, Switzerland) 2021 - “...(mtACP1) At1g65290 (mtACP2) At5g47630 (mtACP3) At4g03240 UniProt O49543-1 O49627-1 Q9LIG6-1 Q9C8J2 Q8L9E3-1 Q8GUM2 Q9LDZ0 Q8L7K4 P53665 O80800 Q9FGJ4 Q9ZR07 Identified Protein Sequences Organism Auxenochlorella protothecoides A0A087SBH3 (c) RMZ55380.1 (c) A0A087SIP0 A0A087SND2 XP_011400182 A0A087SCC7 RMZ53064.1 (c) Bathycoccus prasinos K8FF08 (p) XP_007511837.1 K8F7J7 K8F1V7 XP_007510865 K8FET8 XP_007511602.1 (p)...”
- The complex I subunit B22 contains a LYR domain that is crucial for an interaction with the mitochondrial acyl carrier protein SDAP1
Saha, The Plant journal : for cell and molecular biology 2025 (no snippet) - Transcriptomic and iTRAQ-Based Quantitative Proteomic Analyses of inap CMS in Brassica napus L
Wang, Plants (Basel, Switzerland) 2022 - “...inhibitor 1 0.65 0.0142 AT5G06860 Oxidative phosphorylation BnaA05g04190D Acyl carrier protein 1, mitochondrial 0.82 0.0247 AT2G44620 BnaC02g16510D Acyl carrier protein 2, mitochondrial 0.81 0.0217 AT1G65290 BnaC02g04760D ATP synthase subunit O, mitochondrial 0.7 0.0279 AT5G13450 BnaC04g43510D ATP synthase subunit gamma, mitochondrial 0.68 0.0232 AT2G33040 BnaC07g32820D ATP synthase...”
- Fe-S Protein Synthesis in Green Algae Mitochondria
Gomez-Casati, Plants (Basel, Switzerland) 2021 - “...plants, especially in Arabidopsis thaliana , there are three genes encoding mitochondrial ACPs namely mtACP1 (At2g44620), mtACP2 (At1g65290), and mtACP3 (At5g47630), and five plastidial ACPs, AtACP1 (At3g05020), AtACP2 (At1g54580), AtACP3 (At1g54630), AtACP4 (At4g25050), and AtACP5 (At5g27200) [ 40 ]. It was reported that ACP participates in...”
- “...Arabidopsis thaliana genes At5g65720.1 At4g22220 At3g20970 (NFU4) At1g51390 (NFU5) At5g61220 At4g37910 (HSCA1) At5g09590 (HSCA2) At5g06410 At2g44620 (mtACP1) At1g65290 (mtACP2) At5g47630 (mtACP3) At4g03240 UniProt O49543-1 O49627-1 Q9LIG6-1 Q9C8J2 Q8L9E3-1 Q8GUM2 Q9LDZ0 Q8L7K4 P53665 O80800 Q9FGJ4 Q9ZR07 Identified Protein Sequences Organism Auxenochlorella protothecoides A0A087SBH3 (c) RMZ55380.1 (c) A0A087SIP0...”
- Mitochondrial Fatty Acid Synthase Utilizes Multiple Acyl Carrier Protein Isoforms
Fu, Plant physiology 2020 (PubMed) (secret) - Genes of ACYL CARRIER PROTEIN Family Show Different Expression Profiles and Overexpression of ACYL CARRIER PROTEIN 5 Modulates Fatty Acid Composition and Enhances Salt Stress Tolerance in Arabidopsis
Huang, Frontiers in plant science 2017 - “...genome of the model plant Arabidopsis thaliana harbors three genes encoding mitochondrial ACPs, namely mtACP1 (At2g44620), mtACP2 (At1g65290), and mtACP3 (At5g47630), and five plastidial ACPs, AtACP1 (At3g05020), AtACP2 (At1g54580), AtACP3 (At1g54630), AtACP4 (At4g25050), and AtACP5 (At5g27200) ( Meyer et al., 2007 ). Based on protein analysis,...”
- Identification of cleavage sites and substrate proteins for two mitochondrial intermediate peptidases in Arabidopsis thaliana
Carrie, Journal of experimental botany 2015 - “...carrier protein 2 F FSEEVRGSFLDKSEVTDR SEEVRGSFLDKSEVTDR 58 AT2G27730 Copper ion binding F FSSGKVLSEEER SSGKVLSEEER 59 AT2G44620 Mitochondrial acyl carrier protein 1 F FSSHDDHLSR 60 AT3G03070 NADH-ubiquinone oxidoreductase-related; F FSVATTQLGIPTDDLVGNHTAKWMQDR SVATTQLGIPTDDLVGNHTAKWMQDR 61 AT3G15020 Lactate/malate dehydrogenase family protein F FASESVPDR 62 AT3G15640 Rubredoxin-like superfamily protein F FSSDSVETPATKKVEDVMPIATGHEKEELEAELEGR SSDSVETPATKKVEDVMPIATGHEKEELEAELEGR...”
- Acyl-lipid metabolism
Li-Beisson, The arabidopsis book 2013 - “...condensation steps. The genes for mitochondrial ACP (At2g44620 and At1g65290) and KAS (At2g04540) have been identified in Arabidopsis (Shintani and Ohlrogge,...”
- Proteomic investigations of complex I composition: how to define a subunit?
Meyer, Frontiers in plant science 2012 - “...At2g46540 B9 subunit At5g08050 B14.5a subunit At4g34700 B22 subunit X $ At3g29970 MLQR subunit At1g65290, At2g44620, At5g47630 SDAP subunit NON-CONSERVED BOVINE COMPLEX I 10kDa subunit B17 subunit From six proteomic analyses of Arabidopsis complex I, 49 different proteins were identified (the identification is indicated with X)....”
- More
7b0nU / A0A1D8NG21 3.7-angstrom structure of Yarrowia lipolytica complex I with an R121M mutation in NUCM. (see paper)
52% identity, 68% coverage
- Ligand: ~{s}-[2-[3-[[(2~{r})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{s})-3-oxidanyltetradecanethioate (7b0nU)
LOC108995042 acyl carrier protein 1, chloroplastic-like from Juglans regia
49% identity, 51% coverage
- Integrated Transcriptomic and Proteomic Analysis of Nutritional Quality-Related Molecular Mechanisms in "Longjia", "Yangpao", and "Niangqing" Walnuts (<i>Juglans sigillata</i>)
Wang, International journal of molecular sciences 2024 - “...XP_018833363.1, XP_018834639.1, XP_018806299.1, XP_018840594.1, XP_018842241.1, XP_018849207.1, XP_018860003.1, XP_035544419.1, YP_009186177.1, LOC108986433, LOC108979094, LOC108983105, LOC109002248, LOC108989851, and LOC108995042 ( Figure 6 C). Correlation analysis was conducted between DEGs and DEPs that were collectively and significantly enriched in the KEGG signaling pathway (protein processing in endoplasmic reticulum). High correlations...”
- “...were identified, including XP_018815161.1, LOC109010859, XP_018814223.2, LOC109002248, XP_018806488.2, LOC118348401, LOC109007090, LOC108996994, XP_018830356.1, LOC109004195, XP_018828611.1, XP_018826050.1, LOC108995042, XP_018825366.1, XP_018825271.1, LOC108992677, XP_018819156.1, XP_018816951.1, LOC108998294, and XP_018816525.1 ( Figure 7 B,C). As in the previous section, these proteins and genes may be equally important for fatty acid synthesis in...”
P93092 Acyl carrier protein 1, chloroplastic from Casuarina glauca
49% identity, 51% coverage
- Large-scale proteome comparative analysis of developing rhizomes of the ancient vascular plant equisetum hyemale.
Balbuena, Frontiers in plant science 2012 - “...gamma H. sapiens P49368 0 ACTVLLRGPSK-ALEDAIAALDK-AYHPTVICR-DIGVFDAYNVK-DLLNEVER-ELDLTHPAAR-IAVPIDIDDRK-IDDIVSGIR-IILLDCPLEYK-NLQDAM*GVAR-TAIEAACMLLR-TLAQNCGVNVIR-VEKVPGGTLEDSK-ALEDAIAALDK-DIGVFDAYNVK-IDDIVSGIR-TLAQNCGVNVIR-VEKVPGGTLEDSK-VPGGTLEDSK EhRi_053876 Acyl carrier protein1 C. glauca P93092 4.18e 28 RVVEIVTK-SSRSLKVLCAASPETAK-VVEIVTK-TVQDAADLIER EhRi_031943 AEIDSLRQEVTR-AVEPLKAELHR-LAATHVGLR-LRM*DLVNFEK-LVTQHGEIQR-MDLVNFEK-NLHIM*SREIEKLR-SDIHQLPAM*K-LAATHVGLR-LVTQHGEIQR-MDLVNFEK EhRi_053749 KH domain-containing protein A. thaliana P58223 1.47e 17 GREEESGGGGGEEGKR-RTSGATITIQETR-SIQDTSGATVR-TSGATITIQETR-VFSALELVTSHLR-WPGWPGETVFR-LLVAGTQAGSLIGK-SIQDTSGATVR-VFSALELVTSHLR EhRi_049681 RNA-binding protein Nova-1 R. norvegicus Q80WA4 9.50e 19...”
- “...and elongation zone as a rhizome-characteristic protein (Figure 4 ). Acyl carrier proteins (ACP, accession P93092) are small, acidic proteins that carry the nascent acyl chains during the synthesis of 16- and 18-carbon acyl groups (Bonaventure and Ohlrogge, 2002 ), playing an essential role during plant...”
C3B54_11898 acyl carrier protein from Pontimonas salivibrio
45% identity, 95% coverage
ACP5_ARATH / O04652 Acyl carrier protein 5, chloroplastic from Arabidopsis thaliana (Mouse-ear cress) (see paper)
AT5G27200 ACP5 (acyl carrier protein 5); acyl carrier from Arabidopsis thaliana
47% identity, 52% coverage
- function: Carrier of the growing fatty acid chain in fatty acid biosynthesis.
disruption phenotype: No visible phenotype under normal growth conditions. - Arabidopsis ACYL CARRIER PROTEIN4 and RHOMBOID LIKE10 act independently in chloroplast phosphatidate synthesis
Xu, Plant physiology 2023 - “...AT1G32200 PGP1 Gramene: AT2G39290 PGP1 Araport: AT2G39290 ACP3 Gramene: AT1G54630 ACP3 Araport: AT1G54630 ACP5 Gramene: AT5G27200 ACP5 Araport: AT5G27200 MGD1 Gramene: AT4G31780 MGD1 Araport: AT4G31780 RBL10 Gramene: AT1G25290 RBL10 Araport: AT1G25290 ATS2 Gramene: AT4G30580 ATS2 Araport: AT4G30580 References Alberts AW , Majerus PW , Talamo B...”
- Genome-wide identification and analysis of ACP gene family in Sorghum bicolor (L.) Moench
Ge, BMC genomics 2022 - “...verified by qRT-PCR [ 34 ]. Additionally, previous studies showed that the overexpression of AtACP5 (At5g27200), a plastid localized protein, could increase the content of saturated fatty acids, reduce the Na + /K + ratio, and significantly increase the salt tolerance [ 14 ], indicating that...”
- Fe-S Protein Synthesis in Green Algae Mitochondria
Gomez-Casati, Plants (Basel, Switzerland) 2021 - “...(At5g47630), and five plastidial ACPs, AtACP1 (At3g05020), AtACP2 (At1g54580), AtACP3 (At1g54630), AtACP4 (At4g25050), and AtACP5 (At5g27200) [ 40 ]. It was reported that ACP participates in the synthesis of fatty acids and lipoic acid in many organisms. In the case of algae, as well as for...”
- Identification of SNP loci and candidate genes related to four important fatty acid composition in Brassica napus using genome wide association study
Zhu, PloS one 2019 - “...11046227 10958311 85.07 AT4G31750 1095831111136986 WIN2 HOPW1-1-interacting 2 (WIN2) BnaA09g03610D A09 1823513 1824394 1752479 71.034 AT5G27200 1095831111136986 ACP5 Acyl carrier protein 5 BnaA09g05410D A09 2642292 2646291 2554018 88.274 AT5G23260 17330141984004 TT16 Transparent testa 16 BnaA10g20970D A10 14540117 14540680 14591650 50.970 AT1G77590 25391852943582 LACS9 Long chain acyl-CoA...”
- A transgene design for enhancing oil content in Arabidopsis and Camelina seeds
Zhu, Biotechnology for biofuels 2018 - “...Arabidopsis (itself a target of LEC1) [ 15 ] and identified several candidate genes: ACP5 (At5g27200, acyl carrier protein 5), SUS2 (At5g49190, sucrose synthase 2), PER (At4g25980, peroxidase superfamily protein), hypothetical protein (At3g63040, LOCATED IN endomembrane system protein), SCPL17 (At3g12203, serine carboxypeptidase-like 17), PER1 (At1g48130,1-cysteine peroxiredoxin...”
- “...seed-specific promoter. Another good promoter based on our analysis was pACP5 (acyl carrier protein 5, At5g27200), which is stronger but less seed specific. These promoter combinations with ZmLEC1 worked better than the previously published designs described above. In Arabidopsis lines transformed with pSCPL17:ZmLEC1 , we find...”
- Cytokinin at the Crossroads of Abiotic Stress Signalling Pathways
Pavlů, International journal of molecular sciences 2018 - “...BY PHOSPHATE STARVATION1 [ 169 , 174 ] F12E4_330 AT5G03545 At5g03545 [ 169 ] ACP5 AT5G27200 Acyl carrier protein 5 [ 38 ] RNS1 AT2G02990 Ribonuclease 1 [ 169 , 170 ] SQD2 AT5G01220 Sulfoquinovosyl transferase SQD2 [ 169 ] PAP10 AT2G16430 Purple acid phosphatase 10...”
- Genes of ACYL CARRIER PROTEIN Family Show Different Expression Profiles and Overexpression of ACYL CARRIER PROTEIN 5 Modulates Fatty Acid Composition and Enhances Salt Stress Tolerance in Arabidopsis
Huang, Frontiers in plant science 2017 - “...(At5g47630), and five plastidial ACPs, AtACP1 (At3g05020), AtACP2 (At1g54580), AtACP3 (At1g54630), AtACP4 (At4g25050), and AtACP5 (At5g27200) ( Meyer et al., 2007 ). Based on protein analysis, AtACP1 , AtACP2 , and AtACP3 are expressed in all tissues examined ( Hlousekradojcic et al., 1992 ), whereas AtACP4...”
- Potato tuber expression of Arabidopsis WRINKLED1 increase triacylglycerol and membrane lipids while affecting central carbohydrate metabolism
Hofvander, Plant biotechnology journal 2016 - “...c24708_g1_i1 Acyl Carrier Protein 5 Plastid 124.18 69.96 46.84 463.41 972.60 616.92 3.73 13.90 13.17 AT5G27200 c23512_g1_i1 KetoacylACP Synthase I Plastid 32.15 13.01 9.43 146.19 209.88 160.92 4.55 16.13 17.07 AT5G46290 c24075_g1_i1 KetoacylACP Synthase III Plastid 26.17 14.12 9.32 47.49 90.05 54.64 1.82 6.38 5.86 AT1G62640...”
- More
Q82ZE9 Acyl carrier protein from Enterococcus faecalis (strain ATCC 700802 / V583)
EF3111 acyl carrier protein from Enterococcus faecalis V583
OG1RF_12371 acyl carrier protein from Enterococcus faecalis OG1RF
41% identity, 90% coverage
- Gliotoxin-mediated bacterial growth inhibition is caused by specific metal ion depletion
Downes, Scientific reports 2023 - “...regulator, Fur family 1.6883 0.00314565 4 27.8 Q831T2 Acyl carrier protein 1.27213 0.00210808 2 44.3 Q82ZE9 Copper-exporting P-type ATPase 0.938649 0.0166494 17 29.1 Q838Y5 Spermidine/putrescine ABC transporter, ATP-binding protein 0.935763 0.0242974 2 6.9 Q835Z8 Cold shock protein CspC 0.826335 0.0414736 4 80.3 Q833G3 Cellulose biosynthesis cyclic...”
- “...of acetyl-CoA carboxylase 1.32096 0.0104951 4 32.1 Q830B2 Acyl carrier protein 1.16376 0.0267896 3 55.7 Q82ZE9 Arginine deiminase 1.09113 0.00625365 25 74.3 Q93K67 Mn 2+ /Fe 2+ transporter, NRAMP family 1.04732 0.0290044 3 11.1 Q836Q1 Carbamate kinase 1 1.02868 0.0133442 14 66.8 P0A2X7 Citrate lyase subunit...”
- Enterococcus faecalis Encodes an Atypical Auxiliary Acyl Carrier Protein Required for Efficient Regulation of Fatty Acid Synthesis by Exogenous Fatty Acids
Zhu, mBio 2019 - “...gene encoding a putative second ACP of unknown function. This E. faecalis gene (locus tag EF3111), called acpB in this report, appears to be cotranscribed with the plsX gene of phospholipid synthesis, and its location implies a role in fatty acid metabolism rather than a related...”
- ClpP participates in stress tolerance, biofilm formation, antimicrobial tolerance, and virulence of Enterococcus faecalis
Zheng, BMC microbiology 2020 - “...family protein 0.825 AEA95174.1 ( OG1RF_12487, rplM ) 50S ribosomal protein L13 0.816 AEA95058.1 ( OG1RF_12371, acpP2 ) acyl carrier protein 0.797 AEA93354.1 ( OG1RF_10667 ) hypothetical protein 0.794 AEA93187.1 ( OG1RF_10500 ) ATP-binding protein 0.792 AEA93783.1 ( OG1RF_11096 ) hypothetical protein 0.787 AEA93274.1 ( OG1RF_10587...”
P52414 Acyl carrier protein 4, chloroplastic from Cuphea lanceolata
48% identity, 50% coverage
Q6ZJI9 Acyl carrier protein from Oryza sativa subsp. japonica
50% identity, 51% coverage
- Storage Drives Alterations of Proteomic and Protein Structural Properties in Rice (Oryza sativa L.)
Wang, Foods (Basel, Switzerland) 2022 - “...reductase [NADH]2, acyl-[acyl-carrier-protein] hydrolase, methylcrotonoyl-CoA carboxylase subunit alpha, and two acyl carrier proteins (A3C125 and Q6ZJI9) ( Table 3 , No.8-12). Acetyl coenzyme A (CoA) is the precursor of fatty acid synthesis, and malonyl coenzyme catalyzed by acyl carrier protein is an essential substrate for fatty...”
- “...0.147 / 25 A3C125 Acyl carrier protein OsJ_30173 0.770 0.022 down 1.096 0.300 / 26 Q6ZJI9 Acyl carrier protein Os08g0549300 0.642 0.010 down 1.064 0.541 / Energy/carbohydrate metabolism 27 A0A0P0UZU8 ATP-dependent 6-phosphofructokinase PFK 1.289 0.009 up 1.063 0.088 / 28 A0A0P0W2E0 Glycosyltransferase Os03g0693600 1.768 0.000 up...”
NDUFAB1 / O14561 mitochondrial acyl carrier protein from Homo sapiens (see 6 papers)
ACPM_HUMAN / O14561 Acyl carrier protein, mitochondrial; ACP; CI-SDAP; NADH-ubiquinone oxidoreductase 9.6 kDa subunit from Homo sapiens (Human) (see 8 papers)
43% identity, 45% coverage
- function: Carrier of the growing fatty acid chain in fatty acid biosynthesis (By similarity) (PubMed:27626371). Accessory and non- catalytic subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain (PubMed:27626371). Accessory protein, of the core iron-sulfur cluster (ISC) assembly complex, that regulates, in association with LYRM4, the stability and the cysteine desulfurase activity of NFS1 and participates in the [2Fe-2S] clusters assembly on the scaffolding protein ISCU (PubMed:31664822). The core iron-sulfur cluster (ISC) assembly complex is involved in the de novo synthesis of a [2Fe-2S] cluster, the first step of the mitochondrial iron-sulfur protein biogenesis. This process is initiated by the cysteine desulfurase complex (NFS1:LYRM4:NDUFAB1) that produces persulfide which is delivered on the scaffold protein ISCU in a FXN- dependent manner. Then this complex is stabilized by FDX2 which provides reducing equivalents to accomplish the [2Fe-2S] cluster assembly. Finally, the [2Fe-2S] cluster is transferred from ISCU to chaperone proteins, including HSCB, HSPA9 and GLRX5 (By similarity).
subunit: Mammalian complex I is composed of 45 different subunits (PubMed:12611891). Interacts with ETFRF1 (PubMed:27499296). Identified in a complex composed of MALSU1, MIEF1 upstream open reading frame protein and NDUFAB1; within the trimeric complex, MIEF1 upstream open reading frame protein functions as a bridging scaffold that interacts with MALSU1 on one side, and with NDUFAB1 on the other side. The complex interacts with the mitochondrial large ribosomal subunit (PubMed:28892042, PubMed:30215512, PubMed:35177605). Interacts with alpha-1-microglobulin chain; this interaction is required for the maintenance of mitochondrial redox homeostasis. Component of the mitochondrial core iron-sulfur cluster (ISC) complex composed of NFS1, LYRM4, NDUFAB1, ISCU, FXN, and FDX2; this complex is a heterohexamer containing two copies of each monomer (Probable). Component of the cyteine desulfurase complex composed of NFS1, LYRM4 and NDUFAB1; this complex contributes to the stability and cysteine desulfurase activity of NFS1 (PubMed:31664822). - Mitochondria-derived vesicles and their potential roles in kidney stone disease.
Chaiyarit, Journal of translational medicine 2023 - “...3.4.24.-) 25 SMPDL3A Q92484 Acid sphingomyelinase-like phosphodiesterase 3a (ASM-like phosphodiesterase 3a) (EC 3.1.4.-) 26 NDUFAB1 O14561 Acyl carrier protein, mitochondrial (ACP) (CI-SDAP) (NADH-ubiquinone oxidoreductase 9.6kDa subunit) 27 AGK Q53H12 Acylglycerol kinase, mitochondrial (hAGK) (EC 2.7.1.107) (EC 2.7.1.138) (EC 2.7.1.94) (Multiple substrate lipid kinase) (HsMuLK) (MuLK) (Multi-substrate...”
- iTRAQ-Based Quantitative Proteomics Reveals the Energy Metabolism Alterations Induced by Chlorogenic Acid in HepG2 Cells.
Takahashi, Nutrients 2022 - “...Tropomyosin alpha-3 chain P06753-2 1.28 0.29 1.09 0.35 1.45 0.06 NDUFAB1 Acyl carrier protein, mitochondrial O14561 1.35 0.33 1.30 0.11 1.87 0.06 CYCS Cytochrome c P99999 0.73 0.03 0.69 0.02 0.80 0.07 PDLIM5 PDZ and LIM domain protein 5 Q96HC4 0.83 0.02 0.81 0.02 0.87 0.07...”
- Study on the Mechanism of the Danggui-Chuanxiong Herb Pair on Treating Thrombus through Network Pharmacology and Zebrafish Models
Zhang, ACS omega 2021 - “...T57 NADH dehydrogenase [ubiquinone] 1 subcomplex subunit 4-like2 Q9NRX3 NDUFA4L2 T58 acyl carrier protein, mitochondrial O14561 NDUFAB1 T59 nuclear factor erythroid 2-related factor2 Q14494 NFE2L2 T60 nuclear factor NF-kappa-B p105 subunit P19838 NFKB1 T61 NPC1-like intracellular cholesterol transporter1 Q71UR5 NPC1L1 T62 puromycin-sensitive aminopeptidase P55786 NPEPPS T63...”
- The Effects of Mild Intermittent Hypoxia Exposure on the Abdominal Subcutaneous Adipose Tissue Proteome in Overweight and Obese Men: A First-in-Human Randomized, Single-Blind, and Cross-Over Study.
Van, Frontiers in physiology 2021 - “...2.04 0.018 0.387 17 P48643 CCT5 T-complex protein 1 subunit epsilon 1.15 0.021 0.387 18 O14561 NDUFAB1 Acyl carrier protein, mitochondrial 1.43 0.022 0.387 19 P30626 SRI Sorcin 1.17 0.022 0.387 20 P13473 LAMP2 Lysosome-associated membrane glycoprotein 2 1.85 0.025 0.387 Downregulated Uniprot Gene Protein names...”
- A Highly Conserved Iron-Sulfur Cluster Assembly Machinery between Humans and Amoeba Dictyostelium discoideum: The Characterization of Frataxin.
Olmos, International journal of molecular sciences 2020 - “...ISU COMPLEX DDB_G0279287/XP_641773 Q9Y697 59.9/77.6 87/0 cl18945 (Aspartate aminotransferase) 49448/ 0 ACPMAcyl carrier protein DDB_G0291866/XP_629874 O14561 30.1/48 55/8.0 10 15 cl09936 (Phosphopantetheine attachment site) 2120/ 5.49 10 18 ISCUFe-S cluster assembly enzyme DDB_G0283003/XP_639309 Q9H1K1 50.2/59.4 75/1.0 10 63 PRK11325 (scaffold protein; Provisional) 56179/ 1.51 10 83...”
- Characterization of Odontogenic Differentiation from Human Dental Pulp Stem Cells Using TMT-Based Proteomic Analysis.
Xiao, BioMed research international 2020 - “...Gene name Degree P20674 COX5A 23 O75947 ATP5PD 22 P56556 NDUFA6 21 P10606 COX5B 21 O14561 NDUFAB1 20 O96000 NDUFB10 19 O00483 NDUFA4 19 Q16718 NDUFA5 18 P36542 ATP5F1C 18 O75489 NDUFS3 18 P09669 COX6C 16 P56385 ATP5ME 16 P56134 ATP5MF 16 O95182 NDUFA7 15 Q16795...”
- Exploring the Mitochondrial Degradome by the TAILS Proteomics Approach in a Cellular Model of Parkinson's Disease.
Lualdi, Frontiers in aging neuroscience 2019 - “...). N-term peptide sequence Protein * Type of N-term DA/CTRL (log 2 ) SEM SDMPPLTLEGIQDR O14561 TP-removal 1.25 0.44 LHLGVTPSVIR O14773 TP-removal DA only STQAATQVVLNVPETR O75439 ragging TP-removal 0.92 0.26 SSEAPPLINEDVKR P04843 ragging TP-removal 0.65 0.05 DAPEEEDHVLVLR P07237 TP-removal 0.98 0.24 AKDVKFGADAR P10809 TP-removal 0.72 0.04...”
- Quantitative proteomic analyses of CD4+ and CD8+ T cells reveal differentially expressed proteins in multiple sclerosis patients and healthy controls.
Berge, Clinical proteomics 2019 - “...P67936; Q2TAC2 Tropomyosin alpha-4 chain TPM4 0.015754 0.598 23.0621 0.52458 22.8134 0.46362 70.6 27 0.81 O14561 Acyl carrier protein, mitochondrial NDUFAB1 0.015958 0.2347 23.5152 0.23866 23.7086 0.12417 21.2 4 0.82 Q00653 Nuclear factor NF-kappa-B p100 subunit; nuclear factor NF-kappa-B p52 subunit NFKB2 0.016322 0.322 22.11305 0.2449...”
- More
ACPM_YEAST / P32463 Acyl carrier protein, mitochondrial; ACP; NADH-ubiquinone oxidoreductase 9.6 kDa subunit from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
NP_012729 acyl carrier protein from Saccharomyces cerevisiae S288C
YKL192C Acp1p from Saccharomyces cerevisiae
53% identity, 42% coverage
- function: Carrier of the growing fatty acid chain in fatty acid biosynthesis (By similarity). May be involved in the synthesis of very- long-chain fatty acids. Accessory and non-catalytic subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain (By similarity).
subunit: Complex I is composed of about 30 different subunits - What can be lost? Genomic perspective on the lipid metabolism of Mucoromycota
Sokołowska, IMA fungus 2023 - “...gene duplications in the Mucorales group within the Mucoromycotina subphylum. ACP1 ( S. cerevisiae accession: P32463) gene duplication is prevalent in the Mucorales order except for the Cunninghamellaceae , with additional duplication in Mucoraceae . MCT1 ( S. cerevisiae accession: Q12283) gene duplication was found in...”
- A GX2GX3G motif facilitates acyl chain sequestration by Saccharomyces cerevisiae acyl carrier protein.
Garima, The Journal of biological chemistry 2021 - GeneRIF: A GX2GX3G motif facilitates acyl chain sequestration by Saccharomyces cerevisiae acyl carrier protein.
- ACP Acylation Is an Acetyl-CoA-Dependent Modification Required for Electron Transport Chain Assembly.
Van, Molecular cell 2018 - GeneRIF: ACP acylation is an acetyl-CoA-dependent modification required for electron transport chain assembly.
- Analysis and engineering of substrate shuttling by the acyl carrier protein (ACP) in fatty acid synthases (FASs).
Rossini, Chemical communications (Cambridge, England) 2018 (PubMed)- GeneRIF: This work provides analysis and engineering of substrate shuttling by the acyl carrier protein (ACP) in fatty acid synthases. Perturbations of domain-domain interactions impact the function of type I fatty acid synthases. Identified are interface point mutations that modulate fatty acid chain lengths, and explain their effect in changes of domain-domain binding energetics.
- The mitochondrial acyl carrier protein (ACP) coordinates mitochondrial fatty acid synthesis with iron sulfur cluster biogenesis.
Van, eLife 2016 - GeneRIF: In this study, the authors demonstrate that the mitochondrial acyl carrier protein (ACP), which has a well-known role in mitochondrial fatty acid synthesis (FASII), plays an unexpected and evolutionarily conserved role in iron sulfur cluster biogenesis.
- Comparative Analysis of Yeast Metabolic Network Models Highlights Progress, Opportunities for Metabolic Reconstruction
Heavner, PLoS computational biology 2015 - “...as essential by the Yeast Deletion Project (available at http://www-sequence.stanford.edu/group/yeast_deletion_project/downloads.html ), then removed YCL004W and YKL192C, based upon literature review [ 64 , 65 ]. Since this list was generated from experiments using a complete medium, we used it as our reference for simulations of growth...”
- Phylogenomics of the oxidative phosphorylation in fungi reveals extensive gene duplication followed by functional divergence
Marcet-Houben, BMC evolutionary biology 2009 - “...apparent inconsistencies in the function of Complex I acyl-carrier protein and the isolated ACPM protein (YKL192C). Indeed S. cerevisiae ACPM protein has been found to participate in the synthesis of octanoic acid, a precursor of lipoic acid [ 26 ], whereas the acyl carrier Complex I...”
- How to identify essential genes from molecular networks?
del, BMC systems biology 2009 - “...18 by including the essential genes predicted with every local centrality measure (YBR153W, YDR236C, YDR050C, YKL192C, YNR016C, YBR196C, YDL055C, YBL076C, YPR033C, YPL160W, YFL022C, YDR023W, YGR185C, YHR019C, YGR094W, YDR341C, YBR121C, YDR037W). These genes were classified using the April's 2008 Gene Ontology classification [ 22 ] and found...”
- Optimizing spotting solutions for increased reproducibility of cDNA microarrays
Rickman, Nucleic acids research 2003 - “...YKL012w YKL165c YKL189w YKL114c YKL211c YKL007w YKL184w YKL016c YKL192c YKL142w YKL001c YKL138c YKL216w YKL060c YKL056c YKL182w TOA2 n/a n/a DOA1 ASH1 MRP17...”
- The EGP1 gene may be a positive regulator of protein phosphatase type 1 in the growth control of Saccharomyces cerevisiae
Hisamoto, Molecular and cellular biology 1995 - “...(A) Structure of the EGP1 deletion. The adjacent gene YKL192c is similar to the Neurospora crassa mitochondrial acyl carrier protein gene (6), and MST1 encodes...”
- The Saccharomyces cerevisiae gene SDS22 encodes a potential regulator of the mitotic function of yeast type 1 protein phosphatase
MacKelvie, Molecular and cellular biology 1995 - “...SDS22 is therefore located between the acyl carrier protein gene YKL192c (11) and MST1 on the left arm of chromosome XI. During the completion of this work, our...”
D3ZF13 Acyl carrier protein from Rattus norvegicus
43% identity, 45% coverage
F8WJ64 Acyl carrier protein (Fragment) from Mus musculus
43% identity, 55% coverage
F6ZFT1 Acyl carrier protein (Fragment) from Mus musculus
43% identity, 55% coverage
W5NQT7 Acyl carrier protein from Ovis aries
43% identity, 45% coverage
- Comparative Proteomic Identification of Ram Sperm before and after In Vitro Capacitation
Chen, Animals : an open access journal from MDPI 2024 - “...CHCHD3 26.76 125.87 40.9 9 0.000579 1.52 W5PTU5 SPACA1 32.33 323.31 46.9 11 0.000644 1.87 W5NQT7 NDUFAB1 17.59 33.54 21 4 0.001137 1.53 B2MVX2 SLC25A11 34.21 27.07 12.1 3 0.002582 1.634 W5P657 WDR87 331.92 35.97 2 6 0.003284 2.07 W5P066 CYB5B 16.98 50.35 13.7 2 0.004602...”
- Proteomics and metabolomics combined study on endopathic changes of water-soluble precursors in Tan lamb during postmortem aging
Ji, Food science & nutrition 2022 - “...value 4/0 O18751 Glycogen phosphorylase, muscle form 3.23 1.86E05 P68240 Hemoglobin subunit alpha1/2 3.58 4.64E04 W5NQT7 Acyl carrier protein 2.45 3.79E04 W5NRC7 Troponin T3, fast skeletal type 6.67 2.41E05 W5NVR1 Calciumtransporting ATPase 2.80 3.17E04 W5NYG7 Actin, cytoplasmic 1 0.21 4.44E04 W5NYJ1 Actin, alpha 1, skeletal muscle...”
- “...ID Protein name 4/0 Fold Change 8/4 Fold Change O18751 Glycogen phosphorylase, muscle form 3.23 W5NQT7 Acyl carrier protein 2.45 0.71 W5NRC7 Troponin T3, fast skeletal type 6.67 0.49 W5NYG7 Actin, cytoplasmic 1 0.21 2.96 W5NYJ1 Actin, alpha 1, skeletal muscle 0.12 4.68 W5P118 Troponin I2,...”
- Purification of Ovine Respiratory Complex I Results in a Highly Active and Stable Preparation
Letts, The Journal of biological chemistry 2016 - “...B9VGZ9 (79) NCB accession no. XP_004008450.1 Uniprot no. W5NQT7 (78) NCB accession no. XP_004018002.1 Uniprot no. W5PVD7 (78) Uniprot no. W5Q5T4 (78) NCB...”
ACPM_MOUSE / Q9CR21 Acyl carrier protein, mitochondrial; ACP; CI-SDAP; NADH-ubiquinone oxidoreductase 9.6 kDa subunit from Mus musculus (Mouse) (see paper)
NP_082453 acyl carrier protein, mitochondrial precursor from Mus musculus
43% identity, 45% coverage
- function: Carrier of the growing fatty acid chain in fatty acid biosynthesis (By similarity). Accessory and non-catalytic subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain (PubMed:38575788). Accessory protein, of the core iron-sulfur cluster (ISC) assembly complex, that regulates, in association with LYRM4, the stability and the cysteine desulfurase activity of NFS1 and participates in the [2Fe-2S] clusters assembly on the scaffolding protein ISCU (By similarity). The core iron-sulfur cluster (ISC) assembly complex is involved in the de novo synthesis of a [2Fe-2S] cluster, the first step of the mitochondrial iron-sulfur protein biogenesis. This process is initiated by the cysteine desulfurase complex (NFS1:LYRM4:NDUFAB1) that produces persulfide which is delivered on the scaffold protein ISCU in a FXN-dependent manner. Then this complex is stabilized by FDX2 which provides reducing equivalents to accomplish the [2Fe-2S] cluster assembly. Finally, the [2Fe-2S] cluster is transferred from ISCU to chaperone proteins, including HSCB, HSPA9 and GLRX5 (By similarity).
subunit: Mammalian complex I is composed of 45 different subunits (PubMed:38575788). Interacts with ETFRF1. Identified in a complex composed of MALSU1, MIEF1 upstream open reading frame protein and NDUFAB1; within the trimeric complex, MIEF1 upstream open reading frame protein functions as a bridging scaffold that interacts with MALSU1 on one side, and with NDUFAB1 on the other side. The complex interacts with the mitochondrial large ribosomal subunit. Interacts with alpha-1- microglobulin chain; this interaction is required for the maintenance of mitochondrial redox homeostasis. Component of the mitochondrial core iron-sulfur cluster (ISC) complex composed of NFS1, LYRM4, NDUFAB1, ISCU, FXN, and FDX2; this complex is a heterohexamer containing two copies of each monomer. Component of the cyteine desulfurase complex composed of NFS1, LYRM4 and NDUFAB1; this complex contributes to the stability and cysteine desulfurase activity of NFS1. - NDUFAB1 protects against obesity and insulin resistance by enhancing mitochondrial metabolism.
Zhang, FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2019 - GeneRIF: Skeletal muscle-specific ablation of NDUFAB1 disrupts glucose homeostasis and results in obesity and insulin resistance.
- Effect of the ROCK inhibitor fasudil on the brain proteomic profile in the tau transgenic mouse model of Alzheimer's disease
Collu, Frontiers in aging neuroscience 2024 - “...2-oxoglutarate dehydrogenase complex; Q9D2G2), Etfb (Electron transfer flavoprotein subunit beta; Q9DCW4), Ndufab1 (Acyl carrier protein; Q9CR21), Ndufs3 (NADH dehydrogenase [ubiquinone] iron-sulfur protein 3; Q9DCT2), Me3 (NADP-dependent malic enzyme; Q8BMF3), Ndufa13 (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13; Q9ERS2), Ndufb10 (NADH dehydrogenase [ubiquinone] 1 beta subcomplex...”
- Mitochondrial dysfunction following repeated administration of alprazolam causes attenuation of hippocampus-dependent memory consolidation in mice.
Zhu, Aging 2023 - “...P52503 Ndufs6 13 0.732 0.02905 Q99LY9 Ndufs5 12.6 0.670 0.00241 Q9CQ54 Ndufc2 14.2 0.562 0.00210 Q9CR21 Ndufab1 17.4 1.579 0.00024 Q9CR61 Ndufb7 16.3 0.806 0.01188 Q9DCS9 Ndufb10 21 0.825 0.02277 Q9ERS2 Ndufa13 16.8 1.281 0.00026 Q9CQ92 FIS1 17 0.755 0.00508 P58281 OPA1 115.5 1.335 0.00033 Further,...”
- Fish Hydrolysate Supplementation Prevents Stress-Induced Dysregulation of Hippocampal Proteins Relative to Mitochondrial Metabolism and the Neuronal Network in Mice
Le, Foods (Basel, Switzerland) 2022 - “...down Q921S7 39S ribosomal protein L37 Mrpl37 down Q9ER88 28S ribosomal protein S29 Dap3 down Q9CR21 Acyl carrier protein Ndufab1 down Q9CQX8 28S ribosomal protein S36 Mrps36 down P62897 Cytochrome c, somatic Cycs down Oxidation P09528 Ferritin heavy chain Fth1 down Reduction Q8BK30 NADH dehydrogenase [ubiquinone]...”
- “...flavoprotein 3 Ndufv3 down Q9CQF9 Prenylcysteine oxidase Pcyox1 down Q8BGW1 Alpha-ketoglutarate-dependent dioxygenase FTO Fto down Q9CR21 Acyl carrier protein Ndufab1 down Q8K0C4 Lanosterol 14-alpha demethylase Cyp51a1 down P62897 Cytochrome c, somatic Cycs down Lipid metabolism Q6P549 Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 Inppl1 down Q80Y98 Phospholipase DDHD2 Ddhd2...”
- Age-related disruption of the proteome and acetylome in mouse hearts is associated with loss of function and attenuated by elamipretide (SS-31) and nicotinamide mononucleotide (NMN) treatment.
Whitson, GeroScience 2022 - The amyloid peptide β disrupts intercellular junctions and increases endothelial permeability in a NADPH oxidase 1-dependent manner.
Tarafdar, Redox biology 2022 - “...Ndufb2 0.0286871 Q8BFR5 Elongation factor Tu, mitochondrial Tufm 0.0309189 Q8BVU5 ADP-ribose pyrophosphatase, mitochondrial Nudt9 0.0339598 Q9CR21 Acyl carrier protein, mitochondrial Ndufab1 0.0343109 Q9CZ13 Cytochrome b-c 1 complex subunit 1, mitochondrial Uqcrc1 0.0346424 Q9CTY5 Calcium uptake protein 3, mitochondrial Micu3 0.0350402 P97807 Fumarate hydratase, mitochondrial Fh 0.0374148...”
- Proteomic Analysis of Cardiac Adaptation to Exercise by High Resolution Mass Spectrometry
Al-Menhali, Frontiers in molecular biosciences 2021 - “...Mapt Microtubule-associated protein 749 78 6 P62827 Ran GTP-binding nuclear protein Ran 216 24.4 6 Q9CR21 Ndufab1 Acyl carrier protein, mitochondrial 156 17.4 6 Q8R526 Pkd1l1 Polycystic kidney disease protein 1-like 1 2,615 290.7 6 B7ZCF1 Psmc3 26S proteasome regulatory subunit 6A 451 50.4 6 E9Q3L4...”
- Comparative proteomic study of liver lipid droplets and mitochondria in mice housed at different temperatures
Liu, FEBS letters 2019 - “...small subunit Sdhd 1.83 0.08 Q9ESP1 Stromal cellderived factor 2like protein 1 Sdf2l1 1.61 0.09 Q9CR21 Acyl carrier protein Ndufab1 1.61 0.09 P00186 Cytochrome P450 1A2 Cyp1a2 1.42 0.08 Q99L04 Dehydrogenase/reductase SDR family member 1 Dhrs1 1.41 0.01 Q91X77 Cytochrome P450 2C50 Cyp2c50 1.40 0.09 Q5HZI9...”
- Diverse Protein Profiles in CNS Myeloid Cells and CNS Tissue From Lipopolysaccharide- and Vehicle-Injected APPSWE/PS1ΔE9 Transgenic Mice Implicate Cathepsin Z in Alzheimer's Disease.
Thygesen, Frontiers in cellular neuroscience 2018 - “...1.19 Atp2b4 Q6Q477 0.73 Hist1h1b P43276 0.80 C4b P01029 1.63 0.83 Apbb1 Q9QXJ1 0.82 Ndufab1 Q9CR21 1.14 Eef1b O70251 1.15 Rpl21 O09167 1.17 Tardbp Q921F2 1.11 Ptpr Q64455 0.85 Arhgap23 Q69ZH9 0.83 Tspan2 Q922J6 0.77 Hdgf P51859 1.15 Hapln4 Q80WM4 0.86 D17Wsu104e Q9CPT4 1.11 F8a1 Q00558...”
- More
ACPM_BOVIN / P52505 Acyl carrier protein, mitochondrial; ACP; CI-SDAP; NADH-ubiquinone oxidoreductase 9.6 kDa subunit from Bos taurus (Bovine) (see 3 papers)
TC 3.D.1.6.1 / P52505 SDAP (8), component of The vertebrate H+-translocating NADH dehydrogenase (NDH) complex (45 subunits) from Bos taurus (Bovine) (see paper)
NP_001035578 acyl carrier protein, mitochondrial precursor from Bos taurus
43% identity, 45% coverage
- function: Carrier of the growing fatty acid chain in fatty acid biosynthesis (PubMed:1907568). Accessory and non-catalytic subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain (PubMed:10852722, PubMed:18721790, PubMed:1907568). Accessory protein, of the core iron-sulfur cluster (ISC) assembly complex, that regulates, in association with LYRM4, the stability and the cysteine desulfurase activity of NFS1 and participates in the [2Fe-2S] clusters assembly on the scaffolding protein ISCU (By similarity). The core iron-sulfur cluster (ISC) assembly complex is involved in the de novo synthesis of a [2Fe-2S] cluster, the first step of the mitochondrial iron-sulfur protein biogenesis. This process is initiated by the cysteine desulfurase complex (NFS1:LYRM4:NDUFAB1) that produces persulfide which is delivered on the scaffold protein ISCU in a FXN-dependent manner. Then this complex is stabilized by FDX2 which provides reducing equivalents to accomplish the [2Fe-2S] cluster assembly. Finally, the [2Fe-2S] cluster is transferred from ISCU to chaperone proteins, including HSCB, HSPA9 and GLRX5 (By similarity).
subunit: Mammalian complex I is composed of 45 different subunits (PubMed:10852722, PubMed:18721790). Interacts with ETFRF1. Identified in a complex composed of MALSU1, MIEF1 upstream open reading frame protein and NDUFAB1; within the trimeric complex MIEF1 upstream open reading frame protein functions as a bridging scaffold that interacts with MALSU1 on one side, and with NDUFAB1 on the other side. The complex interacts with the mitochondrial large ribosomal subunit (By similarity). Interacts with alpha-1-microglobulin chain; this interaction is required for the maintenance of mitochondrial redox homeostasis. Component of the mitochondrial core iron-sulfur cluster (ISC) complex composed of NFS1, LYRM4, NDUFAB1, ISCU, FXN, and FDX2; this complex is a heterohexamer containing two copies of each monomer. Component of the cyteine desulfurase complex composed of NFS1, LYRM4 and NDUFAB1; this complex contributes to the stability and cysteine desulfurase activity of NFS1 (By similarity). - substrates: H+
tcdb comment: The 3-d structure of the 44 subunit complex (14 core subunits present in bacteria, plus 30 additional subunits) with a molecular weight of 1 MDa, has been solved at 5 Å resolution by single particle electron cryo-microscopy (Vinothkumar et al. 2014).The core subunits contain eight iron-sulphur clusters and 60 transmembrane helices. The structures of many of the supernumerary subunits were determined or modeled. The structure provided insight into the roles of the supernumerary subunits in regulation, assembly and homeostasis. One such subunit, GRIM-19 or NDUFA13, (Q9P0J0 of the human homologue) is essential for membrane potential formation and NADH assembly (Lu and Cao 2008). Stroud et al. 2016 showed that 25 of the 31 accessory subunits in the 45 subunit human NADH dehydrogenase complex are required for assembly of a functional complex, and 1 subunit is essential for cell viability. Quantitative proteomic analysis revealed that loss of each subunit affects the stability of other subunits residing in the same structural module (Stroud et al. 2016). Leber's hereditary optic neuropathy (LHON) in humans is associated with combinations of individually non-pathogenic missense mitochondrial DNA (mtDNA) variants, affecting the MT-ND4, MT-ND4L and MT-ND6 subunit genes of Complex I (Caporali et al. 2018) - Mammalian mitochondria contain a soluble acyl carrier protein.
Cronan, FEBS letters 2005 (PubMed)- GeneRIF: Data report that SDAP is found in the soluble (matrix) fraction of bovine heart mitochondria and is therefore available to serve as an acyl carrier protein to carry the intermediates of type II fatty acid synthesis.
K3YK68 Acyl carrier protein from Setaria italica
48% identity, 55% coverage
- Comparative proteomic investigation of drought responses in foxtail millet
Pan, BMC plant biology 2018 - “...fatty acid synthase 2.3 K3ZQQ2 acyl-CoA dehydrogenase family member 10-like 2.3 K3XGR5 O-acyltransferase WSD1-like 1.7 K3YK68 Acyl carrier protein 1.9 K3Z5V8 purple acid phosphatase (PAP) 2-like 2.7 K3XZ04 (DL)-glycerol-3-phosphatase (GPP) 2-like 2.2 K4A648 callose synthase 10-like isoform X2 1.5 K3ZN95 UDP-glycosyltransferase 72B3-like 1.6 K3XWQ1 UDP-glycosyltransferase 90A1-like...”
7ak6U / Q9CR21 Cryo-em structure of nd6-p25l mutant respiratory complex i from mus musculus at 3.8 a (see paper)
43% identity, 80% coverage
- Ligand: ~{s}-[2-[3-[[(2~{r})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{s})-3-oxidanyltetradecanethioate (7ak6U)
XP_011544158 acyl carrier protein, mitochondrial isoform X1 from Homo sapiens
43% identity, 37% coverage
- Substrate Sequestration and Chain Flipping in Human Mitochondrial Acyl Carrier Protein.
Suo, Biochemistry 2023 (PubMed)- GeneRIF: Substrate Sequestration and Chain Flipping in Human Mitochondrial Acyl Carrier Protein.
- Structure of the Human ACP-ISD11 Heterodimer.
Herrera, Biochemistry 2019 (PubMed)- GeneRIF: In this work, the structure of the human mitochondrial ACP-ISD11 heterodimer was determined at 2.0 A resolution.
- Architectural Features of Human Mitochondrial Cysteine Desulfurase Complexes from Crosslinking Mass Spectrometry and Small-Angle X-Ray Scattering.
Cai, Structure (London, England : 1993) 2018 - GeneRIF: The molecular structure of the human mitochondrial cysteine desulfurase complex consisting of two copies each of NFS1, ISD11, and acyl carrier protein has been described.
- Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
Hendrickson, PloS one 2010 - GeneRIF: Observational study of gene-disease association. (HuGE Navigator)
- Down-regulation of mitochondrial acyl carrier protein in mammalian cells compromises protein lipoylation and respiratory complex I and results in cell death.
Feng, The Journal of biological chemistry 2009 - GeneRIF: ACP has a dual role in mammalian mitochondrial function
- Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
Saito, Journal of human genetics 2009 (PubMed)- GeneRIF: Observational study of gene-disease association. (HuGE Navigator)
- Identification of a subunit of NADH-dehydrogenase as a p49/STRAP-binding protein.
Zhang, BMC cell biology 2008 - GeneRIF: The p49/STRAP and NDUFAB1 proteins interacted and co-localized with each other in the cell.
- Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
Starr, Mechanisms of ageing and development 2008 (PubMed)- GeneRIF: Observational study of gene-disease association. (HuGE Navigator)
- More
Q9U241 Acyl carrier protein from Caenorhabditis elegans
46% identity, 53% coverage
- Yolk-deprived Caenorhabditis elegans secure brood size at the expense of competitive fitness
Geens, Life science alliance 2023 - “...& Hirsh, 1999 ], VHA-8 [ Choi et al, 2003 ], DOHH-1, HAD-1, PRP-21, SPCS-3, Q9U241 [ Balklava et al, 2007 ], and RAB-35 [ Sato et al, 2008 ]). Taken together, these observations might indicate that in the absence of yolk proteins, ceh-60 mutants try...”
P52412 Acyl carrier protein 2, chloroplastic from Cuphea lanceolata
48% identity, 50% coverage
CHLNCDRAFT_29840 hypothetical protein from Chlorella variabilis
E1Z5W8 Acyl carrier protein from Chlorella variabilis
45% identity, 73% coverage
SCO2389 acyl carrier protein from Streptomyces coelicolor A3(2)
P72393 Acyl carrier protein from Streptomyces coelicolor
52% identity, 76% coverage
- Expression of genes of the Pho regulon is altered in Streptomyces coelicolor
Millan-Oropeza, Scientific reports 2020 - “...Repeats (DR) of the canonical motif, was found just upstream of the 35 region of sco2389 , in position of activator site (Fig. S6C5 ). The functionality of this putative Pho-box has to be confirmed experimentally but since PL biosynthesis mobilizes an important fraction of available...”
- “...synthesize fatty acids. In addition, the very low abundance of the Acyl Carrier Protein (ACP) SCO2389 that belongs to the FasR operon 51 in SC compared to SL is also likely to contribute to the limited fatty acid synthesis of this strain. Overall, these differences in...”
- The Absence of Pupylation (Prokaryotic Ubiquitin-Like Protein Modification) Affects Morphological and Physiological Differentiation in Streptomyces coelicolor
Boubakri, Journal of bacteriology 2015 - “...S. coelicolor SCO1814 AcpP FabF FtsI SCO2090 SCO2318 SCO2389 SCO2390 HupA Tuf1 GroEL1 PurA DnaN GroEL2 ClpC SCO2950 SCO3373 SCO3581 SCO3629 SCO3878 SCO4296...”
- Flavin-linked oxidase catalyzes pyrrolizine formation of dichloropyrrole-containing polyketide extender unit in chlorizidine A
Mantovani, Journal of the American Chemical Society 2013 - “...the native chlorizidine FAS pathway. Clz10 and Clz11 are homologous with the S. coelicolor genes SCO2389 (FabC, 49% identity) and SCO2390 (FabF, 53% identity). While the utilization of diverse starter units by PKSs is greatly appreciated, 1 , 12 there are precious few examples of FASs...”
- Biochemical and structural characterization of germicidin synthase: analysis of a type III polyketide synthase that employs acyl-ACP as a starter unit donor
Chemler, Journal of the American Chemical Society 2012 - “...and Protein Purification E. coli BL21(DE3) strains transformed with either pDHS9758, pDHS10019, and pSG3045, containing Sco2389 (acyl-carrier protein, AcpP), Sco7221 (germicidin synthase, Gcs), and Sco4744 (acyl-carrier protein synthase, AcpS), respectively, were constructed as previously described. 22 E. coli BL21(DE3) strains harboring plasmids pLH14 and pLH16, containing...”
- Polyketide β-branching in bryostatin biosynthesis: identification of surrogate acetyl-ACP donors for BryR, an HMG-ACP synthase
Buchholz, Chemistry & biology 2010 - “...shown). Other reactions without detectable product formation included an Ac-FAS ACP donor from Streptomyces coelicolor (SCO2389, Sc FAS ACP) [ 36 ], an Ac-CoA donor, using BryM3 ACP as both donor and acceptor, or Acac-FAS ACPs or Acac-MacpC as acceptors (data not shown). Since the HMGS...”
- Analysis of gene expression in operons of Streptomyces coelicolor
Laing, Genome biology 2006 - “...predicted to have a TFBS (using the threshold of m b + 5 b ); SCO2389 ( acpP ), SCO0712 ( lipR ), SCO2390 ( fabF ), SCO4662 ( tuf1 ), and SCO5356 ( thrB ). Table 1 details known information about the regulation of these...”
- “...Over-represented intra-operonic genes with predicted TFBS* Gene name Known internal promoter? Organism (reference if known) SCO2389 ( acpP ) Yes Escherichia coli [61] SCO0712 ( lipR ) ? - SCO2390 ( fabF ) Yes Escherichia coli [61] SCO4662 ( tuf1 ) Yes Streptomyces ramocissimus [22] SCO5356...”
- Loading of malonyl-CoA onto tandem acyl carrier protein domains of polyunsaturated fatty acid synthases
Santín, The Journal of biological chemistry 2018 - “...and ACP (Strept) from Streptomyces coelicolor (accession number P72393), ACP (Plasm) from P. falciparum (accession number O77077), and ACP (Brass) from B. napus...”
2kooA / P72393 Nmr solution structures of hexanoyl-acp from the streptomyces coelicolor fatty acid synthase (see paper)
52% identity, 77% coverage
- Ligand: s-[2-({n-[(2s)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] hexanethioate (2kooA)
CAC3577 Acyl Carrier Protein, ACP from Clostridium acetobutylicum ATCC 824
39% identity, 91% coverage
RSp1659 acyl carrier protein from Ralstonia pseudosolanacearum GMI1000
41% identity, 86% coverage
- Of its five acyl carrier proteins, only AcpP1 functions in Ralstonia solanacearum fatty acid synthesis
Yin, Frontiers in microbiology 2022 - “...named acpP2 ), also located on the chromosome. AcpP3, AcpP4, and AcpP5 are encoded by RSp1659, RSp0370, and RSp0369, respectively (now named acpP3 , acpP4 , and acpP5 , respectively), and these genes are encoded on the megaplasmid. However, the function of none of these ACPs...”
- “...be clarified. Discussion The R. solanacearum GMI1000 genome contains five open reading frames, RSc1053, RSc0434, RSp1659, RSp0370, and RSp0369, that encode putative ACPs, AcpP1, AcpP2, AcpP3, AcpP4, and AcpP5, respectively. We confirmed that these ACPs are successfully phosphopantetheinylated and identified the active site at which the...”
Tfu_1975 acyl carrier protein from Thermobifida fusca YX
46% identity, 81% coverage
- The Effects of Carbon Source and Growth Temperature on the Fatty Acid Profiles of Thermobifida fusca
Winkelman, Frontiers in molecular biosciences 2022 - “...subunit Tfu_1228, Tfu_1215 BCCP Biotin Carboxyl-Carrier Protein Tfu_1513 LCCase LCCase Tfu_1530 AcpP Acyl-carrier protein (ACP) Tfu_1975 MCAT Malonyl-CoA:ACP transacylase Tfu_1231, Tfu_1973 FabH 3-ketoacyl-ACP synthase III Tfu_1229, Tfu_1974 FabF 3-ketoacyl-ACP synthase III isozyme Tfu_1976 FabG 3-ketoacyl-ACP reductase Tfu_1841, Tfu_1843, Tfu_2308 FabA 3-hydroxyacyl-ACP dehydratase Unknown FabI Enoyl-ACP reductase...”
- “...Specifically, Tfu_1973 (MCAT) is part of a large operon that includes Tfu_1974 ( FabH ), Tfu_1975 ( ACP ), and Tfu_1976 ( FabF ). Another copy of MCAT is encoded by Tfu_1231, which is also positioned near an additional copy of FabH (Tfu_1229). We found three...”
BB0704 acyl carrier protein from Borrelia burgdorferi B31
O51647 Acyl carrier protein from Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
37% identity, 95% coverage
- Correction: In Vivo Expression Technology Identifies a Novel Virulence Factor Critical for Borrelia burgdorferi Persistence in Mice
Ellis, PLoS pathogens 2014 - “...chromosome BB0381 Trehalase 81 chromosome BB0676 Phosphoglycolate phosphate Fatty acid and phospholipid metabolism 85 chromosome BB0704 AcpP acyl carrier protein Motility and chemotaxis 14 chromosome BB0181 FlgK flagellar hook-associated protein 29 chromosome BB0293 FlgB flagellar basal body rod 290 chromosome BB0775 Flagellar hook-basal body complex protein...”
- In vivo expression technology identifies a novel virulence factor critical for Borrelia burgdorferi persistence in mice
Ellis, PLoS pathogens 2013 - “...chromosome BB0381 Trehalase 81 chromosome BB0676 Phosphoglycolate phosphate Fatty acid and phospholipid metabolism 85 chromosome BB0704 AcpP acyl carrier protein Motility and chemotaxis 14 chromosome BB0181 FlbF putative flagellar protein 29 chromosome BB0293 FlgB flagellar basal body rod 290 chromosome BB0755 Flagellar hook-basal body complex protein...”
- The coenzyme A disulphide reductase of Borrelia burgdorferi is important for rapid growth throughout the enzootic cycle and essential for infection of the mammalian host
Eggers, Molecular microbiology 2011 - “...4 ).Interestingly, the coaD (BB0702) locus is associated with a cluster that includes the acpP (BB0704) coding sequence; acyl carrier protein (AcpP) functions in fatty acid synthesis via the obligatory participation of the covalently bound 4-phosphopantetheine cofactor derived from CoASH( Chan and Vogel, 2010 ; Gherardini...”
- “...) dephospho-CoA kinase/1JJV ( Haemophilus influenza ) 30% identical, E value of 8 10 12 BB0704 ( acpP ) acyl carrier protein/2KWL identical PanB ketopantoate hydroxymethyl- transferase None PanC Pan synthetase None PanD aspartate decarboxylase None PanE 2-dehydropantoate 2-reductase None a see also ( Parsonage et...”
- Profiling of temperature-induced changes in Borrelia burgdorferi gene expression by using whole genome arrays
Ojaimi, Infection and immunity 2003 - “...BB0294 BB0559 BBA15 BB0300 BB0778 BBB19 BB0480 BB0486 BB0704 BB0365 BBA32 BBF20 BB0741 BBA16 BB0256 BBS37 BBQ42 BB0355 BBE10 BBA74 BBA28 BB0175 BB0631 BB0229...”
- “...BB0047 BB0162 BB0486 BB0355 BBA16 BB0741 BB0480 BBQ42 BB0704 BBS37 BB0256 BB0631 BB0044 BB0423 BB0562 BB0803 BB0541 BBF20 BB0061 BB0229 BB0441 BBE21 BBL35...”
- NMR structure of an acyl-carrier protein from Borrelia burgdorferi.
Barnwal, Acta crystallographica. Section F, Structural biology and crystallization communications 2011 - “...Cloning, protein overexpression and sample preparation The gene coding for the acyl-carrier protein (UniProt ID O51647; entry name ACP_BORBU) was amplified from the genomic DNA of B. burgdorferi using standard PCR techniques. The protein will also be referred to as BobuA.00658.a, its SSGCID identifier. The amplified...”
lp_1672 acyl carrier protein from Lactobacillus plantarum WCFS1
lp_1672 acyl carrier protein from Lactiplantibacillus plantarum
37% identity, 93% coverage
Clocel_4143 acyl carrier protein from Clostridium cellulovorans 743B
38% identity, 91% coverage
- Clostridium cellulovorans Proteomic Responses to Butanol Stress
Costa, Frontiers in microbiology 2021 - “...identified among the proteins up-regulated by butanol. Curiously, one of the two acyl carrier proteins (Clocel_4143) encoded by the C. cellulovorans genome was down-regulated. Globally, these data indicate that fatty acid biosynthesis is improved in butanol-challenged cells, which is likely related to a change in fatty...”
XP_629874 NADH dehydrogenase ubiquinone 1, alpha/beta subcomplex from Dictyostelium discoideum AX4
36% identity, 62% coverage
C1L5E9 Acyl carrier protein from Schistosoma japonicum
43% identity, 49% coverage
- Comparative proteomics analysis of Schistosoma japonicum developed in different Oncomelania snails as intermediate hosts
Liu, Frontiers in cellular and infection microbiology 2022 - “...Up C1LVH1 Histone H3 0.7715 Down Q5DET3 Histone H4 0.7581 Down Energy production and conversion C1L5E9 Acyl carrier protein 0.5345 Down Amino acid transport and metabolism Q86EI1 Glutamine synthetase 1.3368 Up H6QX60 Tyrosinase 1 0.6929 Down Carbohydrate transport and metabolism C1LT10 Phosphoglycerate kinase 1.2553 Up C1L9G8...”
- “...Glyceraldehyde-3-phosphate dehydrogenase 0.4602 Down Lipid transport and metabolism C1L9G8 Saposin-like,IPR008139 Saposin B,domain-containing proteinc 0.7773 Down C1L5E9 Acyl carrier protein 0.5345 Down Inorganic ion transport and metabolism Q5DCX4 Ferritin 1.3269 Up C1L8P3 Voltage-dependent anion-selective channel protein 2 1.2775 Up C1LRQ1 Ferritin 0.7790 Down Secondary metabolites biosynthesis, transport...”
ACP1_ARATH / P11829 Acyl carrier protein 1, chloroplastic; ACP-1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
AT3G05020 ACP1 (acyl carrier protein 1); acyl carrier from Arabidopsis thaliana
NP_187153 acyl carrier protein 1 from Arabidopsis thaliana
43% identity, 50% coverage
- function: Carrier of the growing fatty acid chain in fatty acid biosynthesis.
- Low dose ribosomal DNA P-loop mutation affects development and enforces autophagy in Arabidopsis
Shanmugam, RNA biology 2024 - “...RNA binding (RRM-RBD-RNP motifs) domain - AT2G05310 transmembrane protein - AT2G30695 bacterial trigger factor - AT3G05020 acyl carrier protein 1 AtACP1 AT4G39860 hematological/neurological-like protein - AT2G35390 Phosphoribosyltransferase family protein - AT5G26210 alfin-like 4 AtAL4 AT3G58990 isopropylmalate isomerase 1 AtIPM1 AT5G22580 Stress responsive A/B Barrel Domain -...”
- Arabidopsis ACYL CARRIER PROTEIN4 and RHOMBOID LIKE10 act independently in chloroplast phosphatidate synthesis
Xu, Plant physiology 2023 - “...2021 ). In brief, cDNAs (without the predicted transit peptide sequences) encoding AtACP1 (accession number: AT3G05020), AtACP4 (accession number: AT4G25050), AtGPAT (accession number: AT1G32200), AtLPAT (accession number: AT4G30580), and AtSAD (accession number: AT2G43710) were amplified, sequenced, and cloned in vivo into the pNXgate33-3HA prey vector in...”
- “...from this article can be found in the TAIR data libraries under the accession numbers: AT3G05020 (AtACP1), AT4G25050 (AtACP4), AT1G32200 (AtGPAT), AT4G30580 (AtLPAT), AT2G43710 (AtSAD), and AT1G25290 (AtRBL10). Supplementary Material kiad483_Supplementary_Data Click here for additional data file. Acknowledgments We thank Dr Anastasiya Lavell (Michigan State University)...”
- The tomato chloroplast stromal proteome compendium elucidated by leveraging a plastid protein-localization prediction Atlas
Bhattacharya, Frontiers in plant science 2023 - “...Solyc02g091340 Pyridoxal kinase isoform 1, pyridoxal kinase At5g37850 Lipid metabolism Solyc01g067730 ACP5 Acyl carrier protein At3g05020 Solyc12g006870 Acyl-protein thioesterase 2 At5g20060 Solyc06g064640 ABHD11 Alpha/beta hydrolase At4g10030 Solyc07g008310 CMO-like Choline monooxygenase-like At4g29890 Solyc11g072640 trans -2-enoyl-CoA reductase At1g49670 Nucleotide metabolism Solyc05g052260 Appr-1-p processing domain protein At2g40600 Solyc04g080430 5-nucleotidase...”
- Sunflower WRINKLED1 Plays a Key Role in Transcriptional Regulation of Oil Biosynthesis
Lim, International journal of molecular sciences 2022 - “...HaBCCP2 (HanXRQChr02g0042491); HaACP1 (HanXRQChr14g0445471); HaKASI (HanXRQChr17g0564321); HaPKP-1 (HanXRQChr13g0393011); HaActin7 (HannXRQChr14g0446641); AtBCCP2 (AT5G15530); AtPKP-1 (AT5G52920); AtACP1 (AT3G05020); AtKASI (AT5G46290); AtENR1 (AT2G05990); AtENO1 (AT1G74030); AtPDH-E1 (AT1G30120); AtBCCP1 (AT5G16390); AtLPD1 (AT3G16950); AtFAD3 (AT2G29980); AtDGAT1 (AT2G19450); AtPP2A (AT1G13320). Acknowledgments We thank Edgar Cahoon (University of Nebraska-Lincoln) and Peter Drmann (University...”
- Systematic Identification and Validation of Suitable Reference Genes for the Normalization of Gene Expression in Prunella vulgaris under Different Organs and Spike Development Stages
Zheng, Genes 2022 - “...2A subunit AT3G58500 GTGGCTTTGAAAGTGCGCTA 59.41 184 100.20% 0.9936 TGATTCAACCAAGGCGGTCA 59.89 VAB2 SRR7873856.1.1180932 Homeodomain transcription factor AT3G05020 CTCGGAATTGTCGTCAGGCT 60.11 197 98.37% 0.9943 ATCGTTGGCCGTTCAGGAAA 60.25 genes-13-01947-t002_Table 2 Table 2 Stability analysis of 14 candidate reference genes based on BestKeeper software. Rank Total Samples Different Organs Different Periods Gene...”
- Fe-S Protein Synthesis in Green Algae Mitochondria
Gomez-Casati, Plants (Basel, Switzerland) 2021 - “...mitochondrial ACPs namely mtACP1 (At2g44620), mtACP2 (At1g65290), and mtACP3 (At5g47630), and five plastidial ACPs, AtACP1 (At3g05020), AtACP2 (At1g54580), AtACP3 (At1g54630), AtACP4 (At4g25050), and AtACP5 (At5g27200) [ 40 ]. It was reported that ACP participates in the synthesis of fatty acids and lipoic acid in many organisms....”
- Proteomics Analysis of Lipid Droplets from the Oleaginous Alga Chromochloris zofingiensis Reveals Novel Proteins for Lipid Metabolism
Wang, Genomics, proteomics & bioinformatics 2019 - “...Cre17.g715250 8.0E41 AT5G15530 8.0E27 #252 Cz09g30220 - P 1 1 Acyl-carrier protein (ACP) Cre13.g577100 2.0E37 AT3G05020 5.0E21 #254 Cz11g20120 - P 1 1 Long chain acyl-CoA synthetase Cre13.g566650 0.0E+00 AT4G23850 0.0E+00 #280 Cz04g13030 P - 1 1 Phosphatidylethanolamine-binding protein NA NA AT4G20370 3.0E25 Note : The...”
- Genes of ACYL CARRIER PROTEIN Family Show Different Expression Profiles and Overexpression of ACYL CARRIER PROTEIN 5 Modulates Fatty Acid Composition and Enhances Salt Stress Tolerance in Arabidopsis
Huang, Frontiers in plant science 2017 - “...mitochondrial ACPs, namely mtACP1 (At2g44620), mtACP2 (At1g65290), and mtACP3 (At5g47630), and five plastidial ACPs, AtACP1 (At3g05020), AtACP2 (At1g54580), AtACP3 (At1g54630), AtACP4 (At4g25050), and AtACP5 (At5g27200) ( Meyer et al., 2007 ). Based on protein analysis, AtACP1 , AtACP2 , and AtACP3 are expressed in all tissues...”
- More
- An inversion identified in acl1-1 mutant functions as an enhancer of the acl1-1 phenotype.
Kamata, Genes & genetic systems 2008 (PubMed)- GeneRIF: The expression of multiple genes may be involved in the enhancement of the acl1-1 phenotype.
Acl1 / Q9XF20 holo-[acyl carrier protein] from Capsicum chinense (see paper)
46% identity, 52% coverage
7arcU / A0A7S0UWZ2 Cryo-em structure of polytomella complex-i (peripheral arm) (see paper)
57% identity, 61% coverage
- Ligand: s-[2-({n-[(2r)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate (7arcU)
A3C125 Acyl carrier protein from Oryza sativa subsp. japonica
49% identity, 50% coverage
- Storage Drives Alterations of Proteomic and Protein Structural Properties in Rice (Oryza sativa L.)
Wang, Foods (Basel, Switzerland) 2022 - “...synthase, enoyl-[acyl-carrier-protein] reductase [NADH]2, acyl-[acyl-carrier-protein] hydrolase, methylcrotonoyl-CoA carboxylase subunit alpha, and two acyl carrier proteins (A3C125 and Q6ZJI9) ( Table 3 , No.8-12). Acetyl coenzyme A (CoA) is the precursor of fatty acid synthesis, and malonyl coenzyme catalyzed by acyl carrier protein is an essential substrate...”
- “...1.012 0.680 / 24 A3CDM0 Acyl-[acyl-carrier-protein] hydrolase Os11g0659500 1.247 0.010 up 1.041 0.147 / 25 A3C125 Acyl carrier protein OsJ_30173 0.770 0.022 down 1.096 0.300 / 26 Q6ZJI9 Acyl carrier protein Os08g0549300 0.642 0.010 down 1.064 0.541 / Energy/carbohydrate metabolism 27 A0A0P0UZU8 ATP-dependent 6-phosphofructokinase PFK 1.289...”
ACP3_ARATH / P25702 Acyl carrier protein 3, chloroplastic; ACP-3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
AT1G54630 ACP3 (ACYL CARRIER PROTEIN 3); acyl carrier from Arabidopsis thaliana
45% identity, 50% coverage
- function: Carrier of the growing fatty acid chain in fatty acid biosynthesis
- Arabidopsis ACYL CARRIER PROTEIN4 and RHOMBOID LIKE10 act independently in chloroplast phosphatidate synthesis
Xu, Plant physiology 2023 - “...AT1G54580 ATS1 Gramene: AT1G32200 ATS1 Araport: AT1G32200 PGP1 Gramene: AT2G39290 PGP1 Araport: AT2G39290 ACP3 Gramene: AT1G54630 ACP3 Araport: AT1G54630 ACP5 Gramene: AT5G27200 ACP5 Araport: AT5G27200 MGD1 Gramene: AT4G31780 MGD1 Araport: AT4G31780 RBL10 Gramene: AT1G25290 RBL10 Araport: AT1G25290 ATS2 Gramene: AT4G30580 ATS2 Araport: AT4G30580 References Alberts AW...”
- Fe-S Protein Synthesis in Green Algae Mitochondria
Gomez-Casati, Plants (Basel, Switzerland) 2021 - “...(At2g44620), mtACP2 (At1g65290), and mtACP3 (At5g47630), and five plastidial ACPs, AtACP1 (At3g05020), AtACP2 (At1g54580), AtACP3 (At1g54630), AtACP4 (At4g25050), and AtACP5 (At5g27200) [ 40 ]. It was reported that ACP participates in the synthesis of fatty acids and lipoic acid in many organisms. In the case of...”
- Transcriptional activity of transposable elements may contribute to gene expression changes in the syncytium formed by cyst nematode in arabidopsis roots
Piya, Plant signaling & behavior 2017 - “...AT5G27920 AT5G42970 AT5G45920 AT5G46740 AT1G49320 AT1G54630 AT4G14630 AT3G52920 AT5G36140 AT5G36130 AT1G77520 AT1G77530 Annotation PROLINE-RICH EXTENSIN-LIKE...”
- Genes of ACYL CARRIER PROTEIN Family Show Different Expression Profiles and Overexpression of ACYL CARRIER PROTEIN 5 Modulates Fatty Acid Composition and Enhances Salt Stress Tolerance in Arabidopsis
Huang, Frontiers in plant science 2017 - “...(At2g44620), mtACP2 (At1g65290), and mtACP3 (At5g47630), and five plastidial ACPs, AtACP1 (At3g05020), AtACP2 (At1g54580), AtACP3 (At1g54630), AtACP4 (At4g25050), and AtACP5 (At5g27200) ( Meyer et al., 2007 ). Based on protein analysis, AtACP1 , AtACP2 , and AtACP3 are expressed in all tissues examined ( Hlousekradojcic et...”
- Potato tuber expression of Arabidopsis WRINKLED1 increase triacylglycerol and membrane lipids while affecting central carbohydrate metabolism
Hofvander, Plant biotechnology journal 2016 - “...c24708_g2_i1 Acyl Carrier Protein 3 Plastid 94.80 58.05 42.92 311.47 449.23 387.22 3.29 7.74 9.02 AT1G54630 c24708_g1_i1 Acyl Carrier Protein 5 Plastid 124.18 69.96 46.84 463.41 972.60 616.92 3.73 13.90 13.17 AT5G27200 c23512_g1_i1 KetoacylACP Synthase I Plastid 32.15 13.01 9.43 146.19 209.88 160.92 4.55 16.13 17.07...”
- Identification of hydroxy fatty acid and triacylglycerol metabolism-related genes in lesquerella through seed transcriptome analysis
Kim, BMC genomics 2015 - “...homologs of all five isoforms of plastid acyl-carrier proteins (ACP) reported in Arabidopsis (At3g05020, At1g54580, At1g54630, At4g25050, At5g27200) [ 61 ]. Among them, PfACP5 (6 isotigs), corresponding to At5g27200 isoform, was the mostly expressed (Table 5 ). A gene encoding malonyl-CoA ACP transferase (MCMT) was also...”
- Evaluation of candidate reference genes for gene expression normalization in Brassica juncea using real time quantitative RT-PCR
Chandna, PloS one 2012 - “...transcriptome data, sequences of four potential new reference genes: ACP (Acyl carrier proteins, Arabidopsis ortholog At1G54630), SNF (Sucrose non fermenting-1 protein kinase, At3G50500), TMD (Leucine rich trans membrane domain proteins, At5G22600), TIPS-41 (Tonoplastic intrinsic proteins, At4G34270) were selected ( File S1 ). The three remaining genes,...”
P10352 Acyl carrier protein, chloroplastic from Brassica napus
42% identity, 53% coverage
ACP2_ARATH / P25701 Acyl carrier protein 2, chloroplastic; ACP-2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
AT1G54580 ACP2 (ACYL CARRIER PROTEIN 2); acyl carrier from Arabidopsis thaliana
45% identity, 50% coverage
- function: Carrier of the growing fatty acid chain in fatty acid biosynthesis
- Arabidopsis ACYL CARRIER PROTEIN4 and RHOMBOID LIKE10 act independently in chloroplast phosphatidate synthesis
Xu, Plant physiology 2023 - “...paper: ACP4 Gramene: AT4G25050 ACP4 Araport: AT4G25050 ACP1 Gramene: AT3G05020 ACP1 Araport: AT3G05020 ACP2 Gramene: AT1G54580 ACP2 Araport: AT1G54580 ATS1 Gramene: AT1G32200 ATS1 Araport: AT1G32200 PGP1 Gramene: AT2G39290 PGP1 Araport: AT2G39290 ACP3 Gramene: AT1G54630 ACP3 Araport: AT1G54630 ACP5 Gramene: AT5G27200 ACP5 Araport: AT5G27200 MGD1 Gramene: AT4G31780...”
- Fe-S Protein Synthesis in Green Algae Mitochondria
Gomez-Casati, Plants (Basel, Switzerland) 2021 - “...namely mtACP1 (At2g44620), mtACP2 (At1g65290), and mtACP3 (At5g47630), and five plastidial ACPs, AtACP1 (At3g05020), AtACP2 (At1g54580), AtACP3 (At1g54630), AtACP4 (At4g25050), and AtACP5 (At5g27200) [ 40 ]. It was reported that ACP participates in the synthesis of fatty acids and lipoic acid in many organisms. In the...”
- Genes of ACYL CARRIER PROTEIN Family Show Different Expression Profiles and Overexpression of ACYL CARRIER PROTEIN 5 Modulates Fatty Acid Composition and Enhances Salt Stress Tolerance in Arabidopsis
Huang, Frontiers in plant science 2017 - “...namely mtACP1 (At2g44620), mtACP2 (At1g65290), and mtACP3 (At5g47630), and five plastidial ACPs, AtACP1 (At3g05020), AtACP2 (At1g54580), AtACP3 (At1g54630), AtACP4 (At4g25050), and AtACP5 (At5g27200) ( Meyer et al., 2007 ). Based on protein analysis, AtACP1 , AtACP2 , and AtACP3 are expressed in all tissues examined (...”
- Genes affecting novel seed constituents in Limnanthes alba Benth: transcriptome analysis of developing embryos and a new genetic map of meadowfoam
Slabaugh, PeerJ 2015 - “...NA 2 NA 2 At5g05580 ACP Contig 141 Acyl carrier protein 34 787 9 4 At1g54580 LACS4 MF1CK48TV Long-chain acyl-CoA synthetase 1 NA 2 NA 2 NA 2 At4g23850 ACC1 Contig 1339 Homomeric Acetyl-CoA carboxylase 2 697 3 2 At1g36160 KCS11 Contig 248 3-Ketoacyl-CoA synthase 14...”
- Identification of hydroxy fatty acid and triacylglycerol metabolism-related genes in lesquerella through seed transcriptome analysis
Kim, BMC genomics 2015 - “...lesquerella homologs of all five isoforms of plastid acyl-carrier proteins (ACP) reported in Arabidopsis (At3g05020, At1g54580, At1g54630, At4g25050, At5g27200) [ 61 ]. Among them, PfACP5 (6 isotigs), corresponding to At5g27200 isoform, was the mostly expressed (Table 5 ). A gene encoding malonyl-CoA ACP transferase (MCMT) was...”
- A split-ubiquitin yeast two-hybrid screen to examine the substrate specificity of atToc159 and atToc132, two Arabidopsis chloroplast preprotein import receptors
Dutta, PloS one 2014 - “...atToc132G atToc132AG Plastidial Dihydrolipoamide Acetyltransferase (PDA) AT1G34430 48 + Acyl Carrier Protein 2 (ACP 2) AT1G54580 51 + Chaperonin 60 Beta (Cpn60-beta-2) AT1G55490 53 + VQ motif-containing protein (VQ motif) AT2G22880 57 + Outer Plastid Envelope Protein 16-1 (AtOEP16-1) AT2G28900 18 + + ThiaminC (THIC) AT2G29630...”
- An analysis of expressed sequence tags of developing castor endosperm using a full-length cDNA library
Lu, BMC plant biology 2007 - “...At5g60390 elongation factor alpha (EF-1-ALPHA) cn201 15 At2g32060 putative 40S ribosomal protein S12 cn12 14 At1g54580 Acyl carrier protein 1, chloroplast precursor (ACP 1) cn112 13 At1g43800 acyl- [acyl-carrier-protein] desaturase (stearoyl-ACP desaturase) cn155 12 At1g77510 Protein disulfide isomerase precursor (PDI) cn203 12 At3g55440 Triosephosphate isomerase, cytosolic...”
8iufAB 8iufAB (see paper)
44% identity, 81% coverage
- Ligand: s-[2-({n-[(2s)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate (8iufAB)
MMAR_3337 meromycolate extension acyl carrier protein AcpM from Mycobacterium marinum M
MUL_1305 meromycolate extension acyl carrier protein AcpM from Mycobacterium ulcerans Agy99
42% identity, 51% coverage
LOC100281026 acyl carrier protein 2 from Zea mays
46% identity, 50% coverage
- Physiological and proteome studies of maize (Zea mays L.) in response to leaf removal under high plant density
Wei, BMC plant biology 2018 - “..., LOC100282512 , lhcb6 , pco103778a , psbB , psbC , Lhcb51 , ACC1 , LOC100281026 , LOC100383323 , LOC103634525 , gpm853 , Zlp , and LOC100280979 ) relative expression in S 2 and S 4 . In accordance with the protein results, the relative expression...”
- “...relative to the control. Besides, qRT-PCR results also showed that two genes ( ACC1 , LOC100281026 ) related to fatty acid metabolism were more expressed in S 4 treatment compared to S 0 (Additional file 6 : Fig. S3D). These results indicated that removing four leaves...”
ML1654 acyl carrier protein (meromycolate extension) from Mycobacterium leprae TN
41% identity, 51% coverage
MAV_2193 acyl carrier protein from Mycobacterium avium 104
Q73YF9 Acyl carrier protein from Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
MAP1997 AcpM from Mycobacterium avium subsp. paratuberculosis str. k10
MAP_1997, MAP_RS10150, MAVA5_09575 meromycolate extension acyl carrier protein AcpM from Mycobacterium avium subsp. paratuberculosis K-10
42% identity, 51% coverage
- Deciphering the virulence factors of the opportunistic pathogen Mycobacterium colombiense
Gonzalez-Perez, New microbes and new infections 2016 - “...MAV_1611 (codes for transcriptional regulator, TetR family protein), MAV_4258 (codes for the RsbW protein) and MAV_2193 (codes for acyl carrier protein), MAV_2835 (codes for enoyl-CoA hydratase/isomerase family protein), as well as the MAV_3699, MAV_0045, MAV_1178, MAV_1177, MAV_4234, MAV_0139, and MAV_3009 genes (code for hypothetical proteins). According...”
- Identification of Mycobacterium avium subsp. hominissuis secreted proteins using an in vitro system mimicking the phagosomal environment
Chinison, BMC microbiology 2016 - “...Low molecular weight antigen 0 3 0 7 MAV_1178 Hypothetical protein 0 3 0 6 MAV_2193 Acyl carrier protein 1 4 5 6 MAV_4366 10 kDa chaperonin 1 2 5 3 MAV_1177 Hypothetical protein 0 2 0 3 MAV_4283 Probable Cutinase Cut3 0 2 0 8...”
- Surface proteome of "Mycobacterium avium subsp. hominissuis" during the early stages of macrophage infection
McNamara, Infection and immunity 2012 - “...8 9 4 10 6 3 3 12 2 6 MAV_2816 MAV_4489 MAV_3367 MAV_4916 MAV_2193 MAV_3340 MAV_1380 MAV_4963 MAV_4695 MAV_2267 MAV_5146 4 9 2 6 1 3 3 2 3 2 6 5 7 1 8 2 4 4 2...”
- Production and proteomic characterisation of purified protein derivative from Mycobacterium avium subsp. paratuberculosis.
Wynne, Proteome science 2012 - “...34 W sec P60533 MAPK_4266 MAP_4264 groES 10716.1 10 kDa chaperonin + + + + Q73YF9 MAPK_1771 MAP_1997 acpM 12452.9 acyl carrier protein + + + + Q8VU82 MAPK_2159 MAP_1609c fbpB 34692.8 fibronectin-binding antigen 85 complex B + + + + Q00488 MAPK_3842 MAP_3840 dnaK 66518.5...”
- Mammalian cell entry operons; novel and major subset candidates for diagnostics with special reference to Mycobacterium avium subspecies paratuberculosis infection
Hemati, The veterinary quarterly 2019 - “...MAP3936 Chaperonin GroEL 12 MAP4143 Elongation factor Tu 13 MAP3024c HupB 14 MAP3651c FadE3_2 15 MAP1997 Acyl carrier protein 16 MAP3968 Heparin-binding hemagglutinin adhesin-like protein 17 MAP1122 MIHF 18 MAP1589c Alkylhydroperoxidase C 19 MAP1506 Hypothetical protein 20 MAP3362c S-adenosyl-L-homocysteine hydrolase 21 MAP1519 Hypothetical protein 22 MAP2698c...”
- Surface proteome of "Mycobacterium avium subsp. hominissuis" during the early stages of macrophage infection
McNamara, Infection and immunity 2012 - “...NA NA NA NA NA MAP3936 MAP3840 MAP4143 MAP1997 MAP3968 MAP1589c MAP3362c MAP1998 MAP4264 MAP3693 MAP0398c MAP0896 MAP3007 MAP1164 MAP1889c MAP4233 MAP3061c...”
- Localization of proteins in the cell wall of Mycobacterium avium subsp. paratuberculosis K10 by proteomic analysis
He, Proteome science 2010 - “...22187.24 HupB gi| 41409749 MAP3651c FadE3_2 Rv0215c 1 1 6.12 44045.71 N FadE3_2 gi| 41408095 MAP1997 acpP Rv2244 1 3.77 12483.25 N acyl carrier protein gi| 33327135 MAP3968 hbhA Rv0475 3 9.84 21534.4 Y heparin-binding hemagglutinin adhesin-like protein gi| 41407220 MAP1122 mihF Rv1388 2 11.02 20817.01...”
- “...Y Y Y Y gi| 41409791 MAP3693 acetyl-CoA acetyltransferase Y Y Y Y gi| 41408095 MAP1997 acyl carrier protein Y N N N gi| 41407686 MAP1588c AhpD Y Y Y N gi| 41408552 MAP2453c AtpH Y Y N N gi| 41410034 MAP3936 chaperonin GroEL Y Y...”
- Iron-sparing response of Mycobacterium avium subsp. paratuberculosis is strain dependent
Janagama, BMC microbiology 2010 - “...CbhK, ribokinase 1.74 0.3 2.05 1.0 MAP2286c thioredoxin domain containing protein 1.82 0.1 2.04 0.3 MAP1997 acyl carrier protein 1.90 0.5 1.68 0.5 Cellular processes MAP4340 TrxC, thioredoxin 1.50 0.4 2.29 0.3 MAP3840 DnaK molecular chaperone 1.63 0.6 3.52 0.5 Information storage and processing MAP4142 FusA,...”
- Delineating transcriptional crosstalk between Mycobacterium avium subsp. paratuberculosis and human THP-1 cells at the early stage of infection via dual RNA-seq analysis
Park, Veterinary research 2022 - “...glnA1 ; MAP_RS15490, leuD ), Efflux pump (MAP_RS08120, farB ; MAP_RS14920, farB ), Immune invasion (MAP_RS10150, acpXL ), Magnesium uptake (MAP_RS07770, mgtC ), Manganese uptake (MAP_RS17400, ctpC ), mce operons (MAP_RS18510, mce 1B; MAP_RS18515, mce 1C; MAP_RS18520, mce 1D; MAP_RS18525, mce 1E; and MAP_RS18530, mce 1F),...”
- Composition and Potency Characterization of Mycobacterium avium subsp. paratuberculosis Purified Protein Derivatives
Capsel, PloS one 2016 - “...follows: MAP PPD 9801 (PPD-J), M . bovis PPD (PPD-B), M . avium PPD (PPD-A), MAP_1997, MAP_4143, MAP_1138c, MAP_3567, MAP_3061c, MAP_2121c, and MAP_3651c. For all mitogens, 100 l was dispensed into each designated well and each mitogen was cultured in duplicate wells. Plates were covered and...”
- “...highlighted in bold). The strongest skin test response among all recombinant proteins was elicited by MAP_1997, which is annotated as an acyl-carrier protein ( Table 3 ). This protein has not been previously described as an antigen in the literature, although it was listed among surface...”
- Identification of Bicarbonate as a Trigger and Genes Involved with Extracellular DNA Export in Mycobacterial Biofilms
Rose, mBio 2016 - “...Yes MAVA5_09565 18b11 (_09590) 5 genes downstream Yes MAVA5_09570 18b11 (_09590) 4 genes downstream Yes MAVA5_09575 18b11 (_09590) 3 genes downstream Yes MAVA5_09755 41e1 (_09740) 3 genes away MAVA5_11495 46a1 (_11495) Same gene MAVA5_11885 16g11 (_11885) Same gene MAVA5_12085 6g5 (_12060) 5 genes away MAVA5_12110 30e6/44b10...”
- Production and proteomic characterisation of purified protein derivative from Mycobacterium avium subsp. paratuberculosis
Wynne, Proteome science 2012 - “...sec P60533 MAPK_4266 MAP_4264 groES 10716.1 10 kDa chaperonin + + + + Q73YF9 MAPK_1771 MAP_1997 acpM 12452.9 acyl carrier protein + + + + Q8VU82 MAPK_2159 MAP_1609c fbpB 34692.8 fibronectin-binding antigen 85 complex B + + + + Q00488 MAPK_3842 MAP_3840 dnaK 66518.5 molecular chaperone...”
MAB_1878c Meromycolate extension acyl carrier protein AcpM/ Phosphopantetheine-binding precursor from Mycobacterium abscessus ATCC 19977
44% identity, 58% coverage
- Intrabacterial lipid inclusion-associated proteins: a core machinery conserved from saprophyte Actinobacteria to the human pathogen Mycobacterium tuberculosis
Dargham, FEBS open bio 2023 - “...MSMEG_0912 MAB_4094c MMAR_0793 MUL_4537 ML2461c RopMsmeg Rv2244 acpM Meromycolate extension acyl carrier protein Essential MSMEG_4326 MAB_1878c MMAR_3337 MUL_1305 ML1654 RopMsmeg Rv3800c pks13 Polyketide synthase Essential MSMEG_6392 MAB_0180 MMAR_5364 MUL_4983 ML0101 RopMsmeg Rv2524c fas FAS Essential MSMEG_4757 MAB_1512 MMAR_3962 MUL_3818 ML1191 RopMsmeg Rv3790 dprE1 Decaprenylphosphorylbeta d ribose...”
- Unique Features of Mycobacterium abscessus Biofilms Formed in Synthetic Cystic Fibrosis Medium
Belardinelli, Frontiers in microbiology 2021 - “...mycolic acids per se [e.g., fadD32 (MAB_0179) , pks13 (MAB_0180) , inhA (MAB_2722c) , acpM (MAB_1878c) , kasA (MAB_1877c) , kasB (MAB_4608) , etc.] were, on the contrary, expressed at a significantly lower level in early-stage biofilms and/or late biofilms compared to their planktonic counterparts. This...”
EF2884 acyl carrier protein, putative from Enterococcus faecalis V583
Q830B0 Acyl carrier protein from Enterococcus faecalis (strain ATCC 700802 / V583)
39% identity, 96% coverage
- Transcriptomic and functional analysis of NaCl-induced stress in Enterococcus faecalis
Solheim, PloS one 2014 - “...Fatty acid and phospholipid metabolism EF2883 0,08 3,35 2,24 Acyl-carrier-protein Fatty acid and phospholipid metabolism EF2884 0,16 3,18 2,84 3-oxoacyl-(acyl-carrier-protein) synthase III Fatty acid and phospholipid metabolism EF2885 0,39 3,68 2,08 Hypothetical protein Hypothetical protein EF2547 1,42 3,11 1,17 Hypothetical protein Hypothetical protein EF3287 2,1 1,51...”
- Gliotoxin-mediated bacterial growth inhibition is caused by specific metal ion depletion
Downes, Scientific reports 2023 - “...haloacid dehalogenase-like family 1.4352 0.0409972 6 48.6 Q82ZA8 Acyl carrier protein 1.34991 0.0196974 3 88 Q830B0 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 1.32096 0.0104951 4 32.1 Q830B2 Acyl carrier protein 1.16376 0.0267896 3 55.7 Q82ZE9 Arginine deiminase 1.09113 0.00625365 25 74.3 Q93K67 Mn 2+ /Fe...”
ACPM_MYCTU / P9WQF3 Meromycolate extension acyl carrier protein; ACP from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
Rv2244 acyl carrier protein from Mycobacterium tuberculosis H37Rv
NP_216760 meromycolate extension acyl carrier protein from Mycobacterium tuberculosis H37Rv
Mb2268 MEROMYCOLATE EXTENSION ACYL CARRIER PROTEIN ACPM from Mycobacterium bovis AF2122/97
41% identity, 51% coverage
- function: Acyl carrier protein involved in meromycolate extension.
- Structural basis of siderophore export and drug efflux by Mycobacterium tuberculosis
Earp, Nature communications 2025 (no snippet) - Unlocking the potential of miRNAs in detecting pulmonary tuberculosis: prospects and pitfalls
Arya, Expert reviews in molecular medicine 2024 - “...of apoptosis and autophagy in M. tuberculosis . During Mtb infection, acyl carrier protein (AcpM; Rv2244) of Mtb promotes the expression of miR-155, which targets SH2 domain-containing inositol 5-phosphatase-1 (SHIP1) to activate the Akt1/mTOR pathway. The activated Akt1/mTOR signalling pathway inhibits the nuclear translocation of transcription...”
- Intrabacterial lipid inclusion-associated proteins: a core machinery conserved from saprophyte Actinobacteria to the human pathogen Mycobacterium tuberculosis
Dargham, FEBS open bio 2023 - “...MMAR_5353 MUL_4970 ML0108c RopMsmeg Rv0468 fadB2 3hydroxybutyrylCoA dehydrogenase Nonessential MSMEG_0912 MAB_4094c MMAR_0793 MUL_4537 ML2461c RopMsmeg Rv2244 acpM Meromycolate extension acyl carrier protein Essential MSMEG_4326 MAB_1878c MMAR_3337 MUL_1305 ML1654 RopMsmeg Rv3800c pks13 Polyketide synthase Essential MSMEG_6392 MAB_0180 MMAR_5364 MUL_4983 ML0101 RopMsmeg Rv2524c fas FAS Essential MSMEG_4757 MAB_1512...”
- “...(FadA2), Rv0270 (FadD2), Rv1206 (FadD6), Rv1483 (FabG1), Rv2187 (FadD15), Rv0468 (FadB2), Rv3229c (DesA3), Rv0154c (FadE2), Rv2244 (AcpM), Rv3800c (Pks13), Rv2524c (Fas), Rv0400c (FadE7), Rv0824c (DesA1), Rv2501c (AccA1), and Rv2247 (AccD6). Three additional proteins, Rv1544, Rv3720, and Rv0437c, annotated as putative ketoacyl reductase, fattyacylphospholipid synthase, and phosphatidylserine...”
- Mycobacterium tuberculosis Gene Expression Associated With Fluoroquinolone Resistance and Efflux Pump Inhibition
van, The Journal of infectious diseases 2023 - “...and <2 groups when cultured without ofloxacin were Rv2244, Rv3648c, Rv1630, Rv2115c, Rv1388, and Rv3787c (all with positive gene expression fold change >10)...”
- “...of the genes with the most significant differences (Rv2244, Rv3648c, Rv1630, Rv2115c, Rv1388, Rv3787c) were associated with efflux pump, transport, or secretion...”
- Revolutionizing control strategies against Mycobacterium tuberculosis infection through selected targeting of lipid metabolism
Kim, Cellular and molecular life sciences : CMLS 2023 - “...rv3801c H Down accD6 rv2247 H VAN Up Down acpM rv2244 H, Thiolactomycin Up Triclosan Down acpS rv2523c H Up desA1, desA2 rv0824c, rv1094 Down desA2 rv1094 H,...”
- Molecular Mechanisms of MmpL3 Function and Inhibition
Williams, Microbial drug resistance (Larchmont, N.Y.) 2023 - “...protein (ACP) synthase mtFabH (Rv0533c), which condenses a malonyl substrate, carried by the ACP AcpM (Rv2244), to form -keto-thioester. 4345 Malonyl-AcpM is formed by the transfer of malonyl from malonyl-CoA to AcpM by the enzyme mtFabD (Rv2543). 4648 The FAS-II system is composed of several enzymes,...”
- Challenges and the Way forward in Diagnosis and Treatment of Tuberculosis Infection
Chin, Tropical medicine and infectious disease 2023 - “...(23%), TTP from DnaK (Rv0350) (19%), FLL from GarA (Rv1827) (16%), and IPD from AcpM (Rv2244) (16%) [ 238 ]. 5. Clinical and Epidemiological Scoring Clinical and epidemiological scorings are important for accurate diagnosis of TBI as there is no gold standard test for TBI. Diagnosis...”
- Potential Repurposed Drug Candidates for Tuberculosis Treatment: Progress and Update of Drugs Identified in Over a Decade
Sharma, ACS omega 2023 - “...identified as a possible candidate for drug repurposing in a study, wherein Rv0098, Rv0390, Rv3588c, Rv2244, Rv2465c, Rv2763c, Rv3247c, Rv1094, Rv3607c, Rv3048c, Rv0321, and Rv2607 were identified as metabolic drug targets. 119 4.2.6 Anti-Diabetic Drugs Metformin, an anti-diabetic drug, is a disruptor of mitochondrial complex-I of...”
- More
- Decrypting the oscillating nature of the 4'-phosphopantetheine arm in acyl carrier protein AcpM of Mycobacterium tuberculosis.
Biswas, FEBS letters 2019 (PubMed)- GeneRIF: Decrypting the oscillating nature of the 4'-phosphopantetheine arm in acyl carrier protein AcpM of Mycobacterium tuberculosis has been reported.
- Mycobacterium tuberculosis acyl carrier protein inhibits macrophage apoptotic death by modulating the reactive oxygen species/c-Jun N-terminal kinase pathway.
Paik, Microbes and infection (PubMed)- GeneRIF: Overexpressing mycobacterial acyl carrier protein (AcpM) in Mycobacterium smegmatis (M. smegmatis) enhances intracellular survival in primary bone marrow-derived macrophages (BMDMs). AcpM overexpression decreases reactive oxygen species (ROS) generation and activation of c-Jun N-terminal kinase (JNK) signaling. Treatment of BMDMs with recombinant AcpM inhibits the apoptosis and ROS/JNK signaling induced by M. smegmatis.
- Proteome characterization of the culture supernatant of Mycobacterium bovis in different growth stages
Assal, Biochemistry and biophysics reports 2021 - “...S Y 19.1 MPB70 Mb0448 + + + C/S N 56.7 60kDa chaperonin 2- GroL2 Mb2268 + + + C N 12.5 Meromycolate extension acyl carrier protein Mb2898 + + + S/CW Y 22.1 Cell surface glycolipoprotein MPB83 Mb1918c + + + S Y 34.5 Antigen...”
A0R0B3 Meromycolate extension acyl carrier protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
MSMEG_4326 acyl carrier protein from Mycobacterium smegmatis str. MC2 155
MSMEG_4326, MSMEI_4226 meromycolate extension acyl carrier protein AcpM from Mycolicibacterium smegmatis MC2 155
42% identity, 60% coverage
- Interactome Analysis Identifies MSMEI_3879 as a Substrate of Mycolicibacterium smegmatis ClpC1
Ogbonna, Microbiology spectrum 2023 - “...0.02 A0R2E8 fadD6 , MSMEG_5086, MSMEI_4960 Very-long-chain acyl-CoA synthetase (EC 6.2.1.) (EC 6.2.1.3) 0.09 0.08 A0R0B3 acpM , MSMEG_4326, MSMEI_4226 Meromycolate extension acyl carrier protein (ACP) 0.07 0.08 0.11 0.02 A0R042 MSMEG_4254, MSMEI_4153 AMP-binding enzyme 0.03 0.03 A0QYS3 MSMEG_3767, MSMEI_3678 Acyl-CoA synthase 0.07 0.09 A0R616 accD4...”
- Cryo-EM structure of the <i>Mycobacterium smegmatis</i> MmpL5-AcpM complex
Maharjan, mBio 2024 - “...the PHENIX suite ( 12 ) was used to identify the M. smegmatis AcpM protein (MSMEG_4326), which occupied the extra density in the cryo-EM map. The subsequent procedures for model rebuilding were performed using Coot ( 22 ). Structural refinements were accomplished using the phenix.real_space_refine program...”
- Intrabacterial lipid inclusion-associated proteins: a core machinery conserved from saprophyte Actinobacteria to the human pathogen Mycobacterium tuberculosis
Dargham, FEBS open bio 2023 - “...Nonessential MSMEG_0912 MAB_4094c MMAR_0793 MUL_4537 ML2461c RopMsmeg Rv2244 acpM Meromycolate extension acyl carrier protein Essential MSMEG_4326 MAB_1878c MMAR_3337 MUL_1305 ML1654 RopMsmeg Rv3800c pks13 Polyketide synthase Essential MSMEG_6392 MAB_0180 MMAR_5364 MUL_4983 ML0101 RopMsmeg Rv2524c fas FAS Essential MSMEG_4757 MAB_1512 MMAR_3962 MUL_3818 ML1191 RopMsmeg Rv3790 dprE1 Decaprenylphosphorylbeta d...”
- Interactome Analysis Identifies MSMEI_3879 as a Substrate of Mycolicibacterium smegmatis ClpC1
Ogbonna, Microbiology spectrum 2023 - “..., MSMEG_5086, MSMEI_4960 Very-long-chain acyl-CoA synthetase (EC 6.2.1.) (EC 6.2.1.3) 0.09 0.08 A0R0B3 acpM , MSMEG_4326, MSMEI_4226 Meromycolate extension acyl carrier protein (ACP) 0.07 0.08 0.11 0.02 A0R042 MSMEG_4254, MSMEI_4153 AMP-binding enzyme 0.03 0.03 A0QYS3 MSMEG_3767, MSMEI_3678 Acyl-CoA synthase 0.07 0.09 A0R616 accD4 , MSMEG_6391, MSMEI_6223...”
- Cryo-EM Structures and Regulation of Arabinofuranosyltransferase AftD from Mycobacteria
Tan, Molecular cell 2020 - “...protein revealed the presence of M. smegmatis meromycolate extension acyl carrier protein AcpM (KEGG Identifier: MSMEG_4326, Table S2 ), a 99 residue protein that has 39% sequence identity with E. coli ACP. AcpM also has a negatively charged surface (PDB ID: 1KLP, Figure 5B insert) like...”
- A Screen for Protein-Protein Interactions in Live Mycobacteria Reveals a Functional Link between the Virulence-Associated Lipid Transporter LprG and the Mycolyltransferase Antigen 85A
Touchette, ACS infectious diseases 2017 - “...wall synthesis protein MSMEG_4262 Rv2195 qcrA Intermediary Respiration & Metabolism Ubiquinol-cytochrome c reductase iron-sulfur subunit MSMEG_4326 Rv2244 acpM Lipid Metabolism Meromycolate extension acyl carrier protein MSMEG_4533 Rv2400c subI Cell Wall & Cell Processes Probable sulfate-binding lipoprotein MSMEG_4561 Cell Wall & Cell Processes ABC Fe3+-siderophores transporter; periplasmic...”
- Mycobacteriophage SWU1 gp39 can potentiate multiple antibiotics against Mycobacterium via altering the cell wall permeability
Li, Scientific reports 2016 - “...7.45 Rv2242 MabR, mycolic acid biosynthesis regulator MSMEG_4327 4.82 Rv2245 KasA, involved in meromycolate extension MSMEG_4326 4.86 Rv2244 AcpM, lipid metabolism MSMEG_4328 4.14 Rv2246 KasB, lipid metabolism MSMEG_4325 3.75 Rv2243 FadD, lipid metabolism MSMEG_4329 3.50 Rv2247 AccD6, lipid metabolism MSMEG_3580 2.70 Rv0129c lipid metabolism MSMEG_6179 2.12...”
- The Absence of Pupylation (Prokaryotic Ubiquitin-Like Protein Modification) Affects Morphological and Physiological Differentiation in Streptomyces coelicolor
Boubakri, Journal of bacteriology 2015 - “...M M MI MI MI I (R)DLGK(243)QNIR(C) Rv2163c MSMEG_4233 MSMEG_6484 MSMEG_4326 MSMEG_4328 Detected pupylated peptide(s)a Rv2244 Rv2246 K38 O C T S H S O S F L O...”
- Proteome-wide identification of mycobacterial pupylation targets
Poulsen, Molecular systems biology 2010 - “...to as validated targets' ( Table I ). For one of these, acyl carrier protein (MSMEG_4326), two distinct pupylation sites were observed. All pupylated peptides that were identified contained an internal lysine residue, which, due to the loss of the positive charge as a result of...”
- “...site: elongation factor Ts (MSMEG_2520, three sites, total number of lysines: 24), acyl carrier protein (MSMEG_4326, two sites, total number of lysines: 5) and alkylhydroperoxide reductase (MSMEG_4391, three sites, total number of lysines: 11). For further analysis, we pooled the identified pupylated protein sequences and sorted...”
- More
- Interactome Analysis Identifies MSMEI_3879 as a Substrate of Mycolicibacterium smegmatis ClpC1
Ogbonna, Microbiology spectrum 2023 - “...MSMEG_5086, MSMEI_4960 Very-long-chain acyl-CoA synthetase (EC 6.2.1.) (EC 6.2.1.3) 0.09 0.08 A0R0B3 acpM , MSMEG_4326, MSMEI_4226 Meromycolate extension acyl carrier protein (ACP) 0.07 0.08 0.11 0.02 A0R042 MSMEG_4254, MSMEI_4153 AMP-binding enzyme 0.03 0.03 A0QYS3 MSMEG_3767, MSMEI_3678 Acyl-CoA synthase 0.07 0.09 A0R616 accD4 , MSMEG_6391, MSMEI_6223 Propionyl-CoA...”
P17650 Acyl carrier protein, chloroplastic from Brassica napus
49% identity, 48% coverage
B6SJF5 Acyl carrier protein from Zea mays
41% identity, 56% coverage
- Comparative proteomic analysis reveals that exogenous 6-benzyladenine (6-BA) improves the defense system activity of waterlogged summer maize
Hu, BMC plant biology 2020 - “...(Q9LKL4). In addition, proteins involved in fatty acid metabolism such as Acyl carrier protein (B6UHG1, B6SJF5, B4FDG2), Diphosphonucleotide phosphatase1 (C0PES7) and Triglyceride lipases (A0A1D6JA03) were up-accumulated in V36, but down-accumulated in V36-B. However, Fatty acid desaturase8 were down-regulated in V36 and V36-B (Table 2 ; Fig....”
- “...synthase3 OS=Zea mays GN=ZEAMMB73_Zm00001d043727 20 8.2 3 5 3 2.06 2.2E-05 0.50 0.000117 0.24 0.00000415 B6SJF5 Acyl carrier protein OS=Zea mays GN=ZEAMMB73_Zm00001d032019 7 8.4 1 1 1 1.96 2.4E-06 0.72 0.000344 0.37 0.0000025 B6UHG1 Acyl carrier protein OS=Zea mays GN=ZEAMMB73_Zm00001d019186 7 6.8 1 3 1 1.37...”
8iufAC 8iufAC (see paper)
46% identity, 76% coverage
- Ligand: s-[2-({n-[(2s)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate (8iufAC)
SM12261_0045 acyl carrier protein from Streptococcus mitis NCTC 12261
40% identity, 92% coverage
2fvaA / P07854 Structure of 18:0-acp with docked fatty acid (see paper)
45% identity, 84% coverage
- Ligand: 4'-phosphopantetheine (2fvaA)
H3BNK3 Acyl carrier protein (Fragment) from Homo sapiens
46% identity, 47% coverage
SPD_0044 acyl carrier protein, putative from Streptococcus pneumoniae D39
Q8DRN2 Acyl carrier protein from Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
40% identity, 92% coverage
B4FFE7 Acyl carrier protein from Zea mays
41% identity, 82% coverage
LGG_RS10200 acyl carrier protein from Lacticaseibacillus rhamnosus GG
45% identity, 91% coverage
- Ribosome Profiling Reveals Genome-Wide Cellular Translational Regulation in Lacticaseibacillus rhamnosus ATCC 53103 under Acid Stress
Fan, Foods (Basel, Switzerland) 2022 - “...0.0409188 LGG_RS08915 -- 0.86 4.82 2.49 0.0409188 LGG_RS09795 clpC 1.15 19.98 4.12 3.804 10 6 LGG_RS10200 acpP 5.56 33.81 2.6 0.0251229 LGG_RS10665 -- 1.94 10.39 2.42 0.0396827 LGG_RS13400 Cndp1 1.92 15.49 3.01 0.0219037 LGG_RS13405 oppA 1.72 73.85 5.42 2.659E-06 LGG_RS13420 hsp18 0.78 9.47 3.6 0.0001423 LGG_RS13465...”
- “...and tryptophan biosynthesis 0.008 LGG_RS00490, LGG_RS00500 trpF , trpD ko00999 Biosynthesis of secondary metabolitesunclassified 0.029 LGG_RS10200 acpP ko01110 Biosynthesis of secondary metabolites 0.057 LGG_RS00490, LGG_RS00500, LGG_RS13475 trpF , trpD , argH ko01100 Metabolic pathways 0.068 LGG_RS00490, LGG_RS00500, LGG_RS06985, LGG_RS06990, LGG_RS06995, LGG_RS07005, LGG_RS13475 trpF , trpD ,...”
CBU_0034 acyl carrier protein from Coxiella burnetii RSA 493
44% identity, 60% coverage
- Horizontally Acquired Biosynthesis Genes Boost Coxiella burnetii's Physiology
Moses, Frontiers in cellular and infection microbiology 2017 - “...metabolism Another set of genes in C. burnetii that is of putative foreign origin is CBU_0034 to CBU_0038 (Figure 1 ). This gene cluster appears to have originated in either a Deltaproteobacteria or a Spirochete. We validated the HGT origin of this presumptive operon through phylogenetic...”
- “...probable role for this mobile genetic element in HGT (Figure 3B ). Based on homology, CBU_0034 to CBU_0038 encode ACP, FabB, FabZ, FabA, and FabH, respectively, which are involved in the synthesis of unsaturated fatty acids (Zhang and Rock, 2008 ; Feng and Cronan, 2009 )....”
B4FDG2 Acyl carrier protein from Zea mays
43% identity, 49% coverage
- Comparative proteomic analysis reveals that exogenous 6-benzyladenine (6-BA) improves the defense system activity of waterlogged summer maize
Hu, BMC plant biology 2020 - “...In addition, proteins involved in fatty acid metabolism such as Acyl carrier protein (B6UHG1, B6SJF5, B4FDG2), Diphosphonucleotide phosphatase1 (C0PES7) and Triglyceride lipases (A0A1D6JA03) were up-accumulated in V36, but down-accumulated in V36-B. However, Fatty acid desaturase8 were down-regulated in V36 and V36-B (Table 2 ; Fig. 5...”
- “...1 OS=Zea mays GN=ZEAMMB73_Zm00001d046636 12 5.2 1 1 1 1.60 0.00476 1.87 0.001 1.17 0.111 B4FDG2 Acyl carrier protein OS=Zea mays GN=ZEAMMB73_Zm00001d041701 14 17.1 2 6 2 1.94 0.00016 0.93 0.343 0.48 0.000521 B4FVE3 Farnesyl diphosphate synthase3 OS=Zea mays GN=ZEAMMB73_Zm00001d043727 20 8.2 3 5 3 2.06...”
ACP4_ARATH / Q9SW21 Acyl carrier protein 4, chloroplastic from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
AT4G25050 ACP4 (acyl carrier protein 4); acyl carrier from Arabidopsis thaliana
41% identity, 50% coverage
- function: Carrier of the growing fatty acid chain in fatty acid biosynthesis that plays a major role in the biosynthesis of fatty acids in leaves. Required for the biosynthesis of chloroplast photosynthetic membrane lipids such as monogalactosyldiacylglycerol, digalactosyldiacylglycerol and phosphatidylglycerol. Is essential for the biosynthesis of the cuticular wax and cutin polymers in leaves, and for the establishment of systemic acquired resistance (SAR).
disruption phenotype: Small and chlorotic plants with altered cuticule and reduced levels of fatty acids in leaves. - The Shared Proteome of the Apomictic Fern Dryopteris affinis ssp. affinis and Its Sexual Relative Dryopteris oreades
Ojosnegros, International journal of molecular sciences 2022 - “...76 Biotic stress 24640-505_5_ORF2 Q940H6 OST1 Serine/threonine-protein kinase SRK2E 41 362 0 Biotic stress 59878-327_6_ORF2 Q9SW21 ACP4 Acyl carrier protein 4, chloroplastic 14 137 4.47 10 29 Biotic stress 23981-512_3_ORF1 Q38882 PLDALPHA1 Phospholipase D alpha 1 91 810 0 Biotic stress 9434-771_1_ORF2 Q9SUT5 SGT1B Protein SGT1...”
- trans-Zeatin-N-glucosides have biological activity in Arabidopsis thaliana
Hallmark, PloS one 2020 - “.... 5 0 . 6 0 . 3 ACP4 3 ern et al., 2013; up Q9SW21 AT1G76180 tZ- | tZ7G- | tZ9G- Dehydrin ERD14 0 . 3 0 . 2 0 . 2 ERD14 5 ern et al., 2011; ern et al., 2014; down / up...”
- Identification of the Candidate Proteins Related to Oleic Acid Accumulation during Peanut (Arachis hypogaea L.) Seed Development through Comparative Proteome Analysis
Liu, International journal of molecular sciences 2018 - “...Q9FLW9 PKP2 lipid biosynthetic process Araip.10036992.1 1.63 Q9CAP8 LACS9 fatty acid metabolic process Araip.10020945.1 1.61 Q9SW21 ACP4 fatty acid biosynthetic process Araip.10019224.1 1.47 O82399 PMDH1 lipid oxidation Araip.10019122.1 1.46 F4JML5 At4g16800 lipid oxidation Araip.10033415.1 1.44 Q9ZP05 PMDH2 regulation of lipid catabolic process Araip.10019397.1 1.27 Q9LD43 CAC3...”
- “...fatty acid biosynthetic process Kainong70-4 vs. Kainong70-3 Araip.10021376.1 1.57 Q9FKE9 At5g45160 lipid oxidation Araip.10020945.1 1.67 Q9SW21 ACP4 fatty acid biosynthetic process Kainong70-5 vs. Kainong70-4 no identified Kainong70-5 vs. Kainong70-4 Araip.10029908.1 1.87 Q9M9W8 PLPZETA2 lipid oxidation Araip.10020945.1 1.79 Q9SW21 ACP4 fatty acid biosynthetic process Araip.10010590.1 1.45 Q9LDF5...”
- The target of rapamycin kinase is a positive regulator of plant fatty acid and lipid synthesis
Liu, Plant physiology 2025 (no snippet) - Arabidopsis ACYL CARRIER PROTEIN4 and RHOMBOID LIKE10 act independently in chloroplast phosphatidate synthesis
Xu, Plant physiology 2023 - “...cDNAs (without the predicted transit peptide sequences) encoding AtACP1 (accession number: AT3G05020), AtACP4 (accession number: AT4G25050), AtGPAT (accession number: AT1G32200), AtLPAT (accession number: AT4G30580), and AtSAD (accession number: AT2G43710) were amplified, sequenced, and cloned in vivo into the pNXgate33-3HA prey vector in the yeast strain THY.AP5...”
- “...article can be found in the TAIR data libraries under the accession numbers: AT3G05020 (AtACP1), AT4G25050 (AtACP4), AT1G32200 (AtGPAT), AT4G30580 (AtLPAT), AT2G43710 (AtSAD), and AT1G25290 (AtRBL10). Supplementary Material kiad483_Supplementary_Data Click here for additional data file. Acknowledgments We thank Dr Anastasiya Lavell (Michigan State University) for sharing...”
- Role of NPR1 in Systemic Acquired Stomatal Immunity
Guan, Plants (Basel, Switzerland) 2023 - “...CAX-interacting protein 2 (CXIP2) AT5G58250 Unknown protein AT1G15820 Light harvesting complex PS II subunit 6 AT4G25050 Acyl carrier protein 4 AT5G42980 Thioredoxin 3 AT1G08520 ALBINA 1 AT1G35680 Ribosomal protein L21 plants-12-02137-t003_Table 3 Table 3 The top 20 most significantly changed abundant proteins in npr1-1 primed Arabidopsis...”
- Clock and riboswitch control of THIC in tandem are essential for appropriate gauging of TDP levels under light/dark cycles in Arabidopsis
Noordally, iScience 2023 - “...were generated by either substituting the THIC upstream region in pTHIC:THIC:RR with that of ACP4 (At4g25050, -688 to+172bp) using the KpnI and Xma1 restriction sites (see TableS2 for primers used) or by altering the promoter located evening element (AAATATCT) in THIC to the CIRCADIAN CLOCK ASSOCIATED...”
- TurboID-based proteomic profiling of meiotic chromosome axes in Arabidopsis thaliana
Feng, Nature plants 2023 - “...analysis ATC31 AT5G53530 VPS26A membrane Homolog of yeast retromer subunit VPS26 ASY3 Statistical analysis ATC32 AT4G25050 ACP4 chloroplast; cytosol Acyl carrier protein ASY3 Statistical analysis ATC33 AT4G3434O TAF8 nucleus Member of SAGA complex ASY3 Statistical analysis ATC34 AT3G53520 UXS1 endosome; Golgi; membrane Isoform of UDP-glucuronic acid...”
- Genome-wide identification and analysis of ACP gene family in Sorghum bicolor (L.) Moench
Ge, BMC genomics 2022 - “...ACPs might participate in several biological processes. In Arabidopsis, the expression level of AtACP4 ( At4g25050 ), a key gene to the synthesis of fatty acids in chloroplast membrane lipids, was positively correlated with the photosynthetic system, which demonstrated that AtACP4 might play an important role...”
- Clock and riboswitch control of THIC in tandem are essential for appropriate gauging of TDP levels under light/dark cycles in Arabidopsis
Noordally, 2022 - The Sunflower WRINKLED1 Transcription Factor Regulates Fatty Acid Biosynthesis Genes through an AW Box Binding Sequence with a Particular Base Bias
Sánchez, Plants (Basel, Switzerland) 2022 - “...Plastid Y-0.05 HACPS At3g11470 HanXRQr2Chr04g0161011 HACPS-4g 0 Mitochondrion Y-1 HanXRQr2Chr07g0300321 HACPS-7g 1 Mitochondrion Y-1.6 ACP At4g25050 HanXRQr2Chr07g0290651 ( ACP1 ) ACP-7g 2 Plastid Y-0.11 [ 40 ] HanXRQr2Chr08g0343921 ( ACP3 ) 0 Plastid Y-370 [ 40 ] HanXRQr2Chr09g0412861 0 Plastid Y HanXRQr2Chr14g0647771 ( ACP2 ) ACP-14g...”
- More
pWR501_0132 phosphopantetheine-binding protein from Shigella flexneri 5a str. M90T
34% identity, 94% coverage
NP_461802 putative acyl carrier protein from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
30% identity, 90% coverage
SAK_0419 acyl carrier protein from Streptococcus agalactiae A909
38% identity, 92% coverage
- The Role of Regulator Catabolite Control Protein A (CcpA) in Streptococcus agalactiae Physiology and Stress Response
Roux, Microbiology spectrum 2022 - “...considered to be activating, i.e., upstream of the 35 box of their transcriptional unit ( SAK_0419 , SAK_0575-0576 , SAK_0685 , SAK_0902 , SAK_0950 , SAK_1233-1234 , SAK_1394 , and SAK_1640 ). Instead, upregulation of most genes by CcpA probably occurs indirectly. To confirm the predicted...”
- A Vaginal Tract Signal Detected by the Group B Streptococcus SaeRS System Elicits Transcriptomic Changes and Enhances Murine Colonization
Cook, Infection and immunity 2018 - “...biosynthesis and metabolism sak_0416 sak_0417 sak_0418 sak_0419 sak_0420 sak_0421 sak_0422 sak_0423 sak_0424 sak_0425 sak_0426 sak_0427 sak_0428 Fructose and...”
SSU05_1806 acyl carrier protein from Streptococcus suis 05ZYH33
SSU1606 acyl carrier protein (ACP) from Streptococcus suis P1/7
38% identity, 92% coverage
Ssal_01806, T303_03080 acyl carrier protein from Streptococcus salivarius 57.I
38% identity, 92% coverage
- Functional Genomic Analyses of Exopolysaccharide-Producing Streptococcus thermophilus ASCC 1275 in Response to Milk Fermentation Conditions
Wu, Frontiers in microbiology 2019 - “...Acetyl-CoA carboxylase subunit alpha Lipid transport and metabolism T303_04425 0.18 Dehydrogenase Lipid transport and metabolism T303_03080 0.41 Acyl carrier protein Lipid transport and metabolism T303_08665 0.43 RNA helicase T303_04855 0.59 GTP-binding protein T303_02740 0.34 NrdR family transcriptional regulator T303_08865 0.49 Aminoglycoside phosphotransferase T303_07285 0.56 Aconitate hydratase...”
- “...on Other Biological Processes in ST1275 As shown in Table 1 , acyl carrier protein (T303_03080) was 2.44-fold down regulated; this carrier binds all fatty acyl intermediate metabolites during fatty acid (FA) biosynthesis ( Chan and Vogel, 2010 ). Thus, we believe that FA biosynthesis in...”
- Impact of growth pH and glucose concentrations on the CodY regulatory network in Streptococcus salivarius
Geng, BMC genomics 2018 - “...ns 0.12 0.14 Ssal_01804 fabD 0.09 0.38 0.12 0.16 Ssal_01805 fabK 0.06 ns 0.04 0.16 Ssal_01806 acpP 0.31 0.36 0.16 ns Ssal_01807 fabH 0.25 0.50 0.17 0.20 Ssal_01838 0.21 0.07 0.15 0.19 Ssal_02030 cpdB 0.01 0.07 0.12 0.10 Ssal_02089 cysE 0.26 0.43 0.10 0.16 Ssal_00154 8.3...”
cg2473 acyl carrier protein from Corynebacterium glutamicum ATCC 13032
39% identity, 73% coverage
MAFF_RS05885 acyl carrier protein from Mesorhizobium japonicum MAFF 303099
mlr1174 acyl carrier protein from Mesorhizobium loti MAFF303099
39% identity, 60% coverage
Q8DSN3 Acyl carrier protein from Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
38% identity, 92% coverage
- Systematic analysis of lysine malonylation in Streptococcus mutans
Li, Frontiers in cellular and infection microbiology 2022 - “...in this analysis ( P = 1.0 10 -3 ), and two acyl carrier proteins (Q8DSN3, Q8DWL8) were involved, indicating that Kmal might play a functional role in regulating fatty acid or polyketide biosynthesis. Figure2 Functional enrichment analysis of all identified Kmal substrates in our proteomic...”
T_RS14120 acyl carrier protein from Salmonella enterica subsp. enterica serovar Typhi str. Ty2
STY3004 probable acyl carrier protein from Salmonella enterica subsp. enterica serovar Typhi str. CT18
t2783 probable acyl carrier protein from Salmonella enterica subsp. enterica serovar Typhi Ty2
30% identity, 90% coverage
LACR_0822 Acyl carrier protein from Lactococcus lactis subsp. cremoris SK11
38% identity, 95% coverage
7b0nT / A0A1H6PXT9 3.7-angstrom structure of Yarrowia lipolytica complex I with an R121M mutation in NUCM. (see paper)
59% identity, 63% coverage
- Ligand: ~{s}-[2-[3-[[(2~{r})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{s})-3-oxidanyltetradecanethioate (7b0nT)
B488_RS04700 acyl carrier protein from Liberibacter crescens BT-1
40% identity, 54% coverage
SSP35_09_01940 acyl carrier protein from Streptomyces sp. NBRC 110611
36% identity, 95% coverage
- Draft genome sequence of Streptomyces sp. MWW064 for elucidating the rakicidin biosynthetic pathway
Komaki, Standards in genomic sciences 2016 - “...59/69 KDQ65969 SSP35_09_01950 358 3-oxoacyl-ACP synthase 3-oxoacyl-ACP synthase [ Streptomyces sp. NRRL S-920] 77/87 WP_030791445 SSP35_09_01940 79 ACP phosphopantetheine-binding protein [ Streptomyces bingchenggensis BCW-1] 68/79 ADI05068 SSP35_09_01930 406 ketosynthase 3-oxoacyl-ACP synthase [ Streptomyces sp. NRRL S-15] 81/89 WP_031089521 SSP35_09_01920 146 unknown methylmalonyl-CoA epimerase [ Salinispora pacifica...”
- “...RakH, RakL, RakN, and RakO, previously reported in the reference [ 8 ], respectively, and SSP35_09_01940 may possibly be corresponding to RakI Fig. 3 Genetic map of rakicidin biosynthetic gene cluster of Streptomyces sp. MWW064 and the biosynthetic mechanism of rakicidin D Identification of biosynthetic precursors...”
PP2777 acyl carrier protein, putative from Pseudomonas putida KT2440
32% identity, 37% coverage
Q8DWL8 Acyl carrier protein from Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
27% identity, 89% coverage
- Systematic analysis of lysine malonylation in Streptococcus mutans
Li, Frontiers in cellular and infection microbiology 2022 - “...this analysis ( P = 1.0 10 -3 ), and two acyl carrier proteins (Q8DSN3, Q8DWL8) were involved, indicating that Kmal might play a functional role in regulating fatty acid or polyketide biosynthesis. Figure2 Functional enrichment analysis of all identified Kmal substrates in our proteomic study....”
A0A078E790 Acyl carrier protein from Brassica napus
43% identity, 46% coverage
LSA0814 Acyl carrier protein from Lactobacillus sakei subsp. sakei 23K
32% identity, 95% coverage
- Global transcriptome response in Lactobacillus sakei during growth on ribose
McLeod, BMC microbiology 2011 - “...LSA0812 fabZ1 (3R)-hydroxymyristoyl-[acyl-carrier protein] dehydratase -0.7 0.5 LSA0813 fabH 3-oxoacyl-[acyl carrier protein] synthetase III 0.6 LSA0814 acpP Acyl carrier protein 0.6 LSA0815 fabD Malonyl-CoA:ACP transacylase -0.7 0.7 LSA0816 fabG 3-oxoacyl-acyl carrier protein reductase -0.7 LSA0817 fabF 3-oxoacyl-[acyl carrier protein] synthetase II -0.7 LSA0819 fabZ (3R)-hydroxymyristoyl-[acyl carrier...”
Gmet_1689 Phosphopantetheine-binding protein from Geobacter metallireducens GS-15
38% identity, 82% coverage
For advice on how to use these tools together, see
Interactive tools for functional annotation of bacterial genomes.
The PaperBLAST database links 793,807 different protein sequences to 1,259,118 scientific articles. Searches against EuropePMC were last performed on March 13 2025.
PaperBLAST builds a database of protein sequences that are linked
to scientific articles. These links come from automated text searches
against the articles in EuropePMC
and from manually-curated information from GeneRIF, UniProtKB/Swiss-Prot,
BRENDA,
CAZy (as made available by dbCAN),
BioLiP,
CharProtDB,
MetaCyc,
EcoCyc,
TCDB,
REBASE,
the Fitness Browser,
and a subset of the European Nucleotide Archive with the /experiment tag.
Given this database and a protein sequence query,
PaperBLAST uses protein-protein BLAST
to find similar sequences with E < 0.001.
To build the database, we query EuropePMC with locus tags, with RefSeq protein
identifiers, and with UniProt
accessions. We obtain the locus tags from RefSeq or from MicrobesOnline. We use
queries of the form "locus_tag AND genus_name" to try to ensure that
the paper is actually discussing that gene. Because EuropePMC indexes
most recent biomedical papers, even if they are not open access, some
of the links may be to papers that you cannot read or that our
computers cannot read. We query each of these identifiers that
appears in the open access part of EuropePMC, as well as every locus
tag that appears in the 500 most-referenced genomes, so that a gene
may appear in the PaperBLAST results even though none of the papers
that mention it are open access. We also incorporate text-mined links
from EuropePMC that link open access articles to UniProt or RefSeq
identifiers. (This yields some additional links because EuropePMC
uses different heuristics for their text mining than we do.)
For every article that mentions a locus tag, a RefSeq protein
identifier, or a UniProt accession, we try to select one or two
snippets of text that refer to the protein. If we cannot get access to
the full text, we try to select a snippet from the abstract, but
unfortunately, unique identifiers such as locus tags are rarely
provided in abstracts.
PaperBLAST also incorporates manually-curated protein functions:
- Proteins from NCBI's RefSeq are included if a
GeneRIF
entry links the gene to an article in
PubMed®.
GeneRIF also provides a short summary of the article's claim about the
protein, which is shown instead of a snippet.
- Proteins from Swiss-Prot (the curated part of UniProt)
are included if the curators
identified experimental evidence for the protein's function (evidence
code ECO:0000269). For these proteins, the fields of the Swiss-Prot entry that
describe the protein's function are shown (with bold headings).
- Proteins from BRENDA,
a curated database of enzymes, are included if they are linked to a paper in PubMed
and their full sequence is known.
- Every protein from the non-redundant subset of
BioLiP,
a database
of ligand-binding sites and catalytic residues in protein structures, is included. Since BioLiP itself
does not include descriptions of the proteins, those are taken from the
Protein Data Bank.
Descriptions from PDB rely on the original submitter of the
structure and cannot be updated by others, so they may be less reliable.
(For SitesBLAST and Sites on a Tree, we use a larger subset of BioLiP so that every
ligand is represented among a group of structures with similar sequences, but for
PaperBLAST, we use the non-redundant set provided by BioLiP.)
- Every protein from EcoCyc, a curated
database of the proteins in Escherichia coli K-12, is included, regardless
of whether they are characterized or not.
- Proteins from the MetaCyc metabolic pathway database
are included if they are linked to a paper in PubMed and their full sequence is known.
- Proteins from the Transport Classification Database (TCDB)
are included if they have known substrate(s), have reference(s),
and are not described as uncharacterized or putative.
(Some of the references are not visible on the PaperBLAST web site.)
- Every protein from CharProtDB,
a database of experimentally characterized protein annotations, is included.
- Proteins from the CAZy database of carbohydrate-active enzymes
are included if they are associated with an Enzyme Classification number.
Even though CAZy does not provide links from individual protein sequences to papers,
these should all be experimentally-characterized proteins.
- Proteins from the REBASE database
of restriction enzymes are included if they have known specificity.
- Every protein with an evidence-based reannotation (based on mutant phenotypes)
in the Fitness Browser is included.
- Sequence-specific transcription factors (including sigma factors and DNA-binding response regulators)
with experimentally-determined DNA binding sites from the
PRODORIC database of gene regulation in prokaryotes.
- Putative transcription factors from RegPrecise
that have manually-curated predictions for their binding sites. These predictions are based on
conserved putative regulatory sites across genomes that contain similar transcription factors,
so PaperBLAST clusters the TFs at 70% identity and retains just one member of each cluster.
- Coding sequence (CDS) features from the
European Nucleotide Archive (ENA)
are included if the /experiment tag is set (implying that there is experimental evidence for the annotation),
the nucleotide entry links to paper(s) in PubMed,
and the nucleotide entry is from the STD data class
(implying that these are targeted annotated sequences, not from shotgun sequencing).
Also, to filter out genes whose transcription or translation was detected, but whose function
was not studied, nucleotide entries or papers with more than 25 such proteins are excluded.
Descriptions from ENA rely on the original submitter of the
sequence and cannot be updated by others, so they may be less reliable.
Except for GeneRIF and ENA,
the curated entries include a short curated
description of the protein's function.
For entries from BioLiP, the protein's function may not be known beyond binding to the ligand.
Many of these entries also link to articles in PubMed.
For more information see the
PaperBLAST paper (mSystems 2017)
or the code.
You can download PaperBLAST's database here.
Changes to PaperBLAST since the paper was written:
- November 2023: incorporated PRODORIC and RegPrecise. Many PRODORIC entries were not linked to a protein sequence (no UniProt identifier), so we added this information.
- February 2023: BioLiP changed their download format. PaperBLAST now includes their non-redundant subset. SitesBLAST and Sites on a Tree use a larger non-redundant subset that ensures that every ligand is represented within each cluster. This should ensure that every binding site is represented.
- June 2022: incorporated some coding sequences from ENA with the /experiment tag.
- March 2022: incorporated BioLiP.
- April 2020: incorporated TCDB.
- April 2019: EuropePMC now returns table entries in their search results. This has expanded PaperBLAST's database, but most of the new entries are of low relevance, and the resulting snippets are often just lists of locus tags with annotations.
- February 2018: the alignment page reports the conservation of the hit's functional sites (if available from from Swiss-Prot or UniProt)
- January 2018: incorporated BRENDA.
- December 2017: incorporated MetaCyc, CharProtDB, CAZy, REBASE, and the reannotations from the Fitness Browser.
- September 2017: EuropePMC no longer returns some table entries in their search results. This has shrunk PaperBLAST's database, but has also reduced the number of low-relevance hits.
Many of these changes are described in Interactive tools for functional annotation of bacterial genomes.
PaperBLAST cannot provide snippets for many of the papers that are
published in non-open-access journals. This limitation applies even if
the paper is marked as "free" on the publisher's web site and is
available in PubmedCentral or EuropePMC. If a journal that you publish
in is marked as "secret," please consider publishing elsewhere.
Many important articles are missing from PaperBLAST, either because
the article's full text is not in EuropePMC (as for many older
articles), or because the paper does not mention a protein identifier such as a locus tag, or because of PaperBLAST's heuristics. If you notice an
article that characterizes a protein's function but is missing from
PaperBLAST, please notify the curators at UniProt
or add an entry to GeneRIF.
Entries in either of these databases will eventually be incorporated
into PaperBLAST. Note that to add an entry to UniProt, you will need
to find the UniProt identifier for the protein. If the protein is not
already in UniProt, you can ask them to create an entry. To add an
entry to GeneRIF, you will need an NCBI Gene identifier, but
unfortunately many prokaryotic proteins in RefSeq do not have
corresponding Gene identifers.
References
PaperBLAST: Text-mining papers for information about homologs.
M. N. Price and A. P. Arkin (2017). mSystems, 10.1128/mSystems.00039-17.
Europe PMC in 2017.
M. Levchenko et al (2017). Nucleic Acids Research, 10.1093/nar/gkx1005.
Gene indexing: characterization and analysis of NLM's GeneRIFs.
J. A. Mitchell et al (2003). AMIA Annu Symp Proc 2003:460-464.
UniProt: the universal protein knowledgebase.
The UniProt Consortium (2016). Nucleic Acids Research, 10.1093/nar/gkw1099.
BRENDA in 2017: new perspectives and new tools in BRENDA.
S. Placzek et al (2017). Nucleic Acids Research, 10.1093/nar/gkw952.
The EcoCyc database: reflecting new knowledge about Escherichia coli K-12.
I. M. Keeseler et al (2016). Nucleic Acids Research, 10.1093/nar/gkw1003.
The MetaCyc database of metabolic pathways and enzymes.
R. Caspi et al (2018). Nucleic Acids Research, 10.1093/nar/gkx935.
CharProtDB: a database of experimentally characterized protein annotations.
R. Madupu et al (2012). Nucleic Acids Research, 10.1093/nar/gkr1133.
The carbohydrate-active enzymes database (CAZy) in 2013.
V. Lombard et al (2014). Nucleic Acids Research, 10.1093/nar/gkt1178.
The Transporter Classification Database (TCDB): recent advances
M. H. Saier, Jr. et al (2016). Nucleic Acids Research, 10.1093/nar/gkv1103.
REBASE - a database for DNA restriction and modification: enzymes, genes and genomes.
R. J. Roberts et al (2015). Nucleic Acids Research, 10.1093/nar/gku1046.
Deep annotation of protein function across diverse bacteria from mutant phenotypes.
M. N. Price et al (2016). bioRxiv, 10.1101/072470.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory