Comparing SMc00573 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P19372 Acyl carrier protein AcpP; ACP from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see 2 papers)
100% identity, 100% coverage: 1:78/78 of query aligns to 1:78/78 of P19372
P12784 Acyl carrier protein; ACP from Cereibacter sphaeroides (Rhodobacter sphaeroides) (see 2 papers)
81% identity, 88% coverage: 1:69/78 of query aligns to 1:69/70 of P12784
P80920 Acyl carrier protein; ACP from Leucothrix mucor (see paper)
61% identity, 99% coverage: 1:77/78 of query aligns to 1:77/77 of P80920
P80923 Acyl carrier protein; ACP from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) (see paper)
62% identity, 100% coverage: 1:78/78 of query aligns to 1:78/78 of P80923
P0A6A8 Acyl carrier protein; ACP; Cytosolic-activating factor; CAF; Fatty acid synthase acyl carrier protein from Escherichia coli (strain K12) (see 4 papers)
62% identity, 100% coverage: 1:78/78 of query aligns to 1:78/78 of P0A6A8
P80922 Acyl carrier protein; ACP from Oceanospirillum linum (see paper)
62% identity, 94% coverage: 1:73/78 of query aligns to 1:73/77 of P80922
5vcbD Crystal structure of holo-(acyl-carrier-protein) synthase:holo(acyl- carrier-protein) complex from escherichia coli. (see paper)
61% identity, 99% coverage: 2:78/78 of query aligns to 1:77/77 of 5vcbD
4kehC Crosslinked crystal structure of type ii fatty synthase dehydratase, faba, and acyl carrier protein, acpp (see paper)
61% identity, 99% coverage: 2:78/78 of query aligns to 1:77/77 of 4kehC
3ny7B Stas domain of ychm bound to acp (see paper)
61% identity, 99% coverage: 2:78/78 of query aligns to 1:77/77 of 3ny7B
2faeA Crystal structure of e. Coli decanoyl-acp (see paper)
61% identity, 99% coverage: 2:78/78 of query aligns to 1:77/77 of 2faeA
2fadA Crystal structure of e. Coli heptanoyl-acp (see paper)
61% identity, 99% coverage: 2:78/78 of query aligns to 1:77/77 of 2fadA
2facA Crystal structure of e. Coli hexanoyl-acp (see paper)
61% identity, 99% coverage: 2:78/78 of query aligns to 1:77/77 of 2facA
2ehtA Crystal structure of acyl carrier protein from aquifex aeolicus (form 2)
59% identity, 90% coverage: 4:73/78 of query aligns to 2:71/77 of 2ehtA
1l0iA Crystal structure of butyryl-acp i62m mutant (see paper)
60% identity, 99% coverage: 2:78/78 of query aligns to 1:77/77 of 1l0iA
P80918 Acyl carrier protein; ACP from Comamonas testosteroni (Pseudomonas testosteroni) (see paper)
56% identity, 100% coverage: 1:78/78 of query aligns to 1:78/78 of P80918
2qnwA Toxoplasma gondii apicoplast-targeted acyl carrier protein
59% identity, 96% coverage: 4:78/78 of query aligns to 6:80/80 of 2qnwA
Sites not aligning to the query:
6n3pI Crosslinked acpp=fabz complex from e. Coli type ii fas (see paper)
63% identity, 92% coverage: 2:73/78 of query aligns to 2:73/76 of 6n3pI
5usrK Crystal structure of human nfs1-isd11 in complex with e. Coli acyl- carrier protein at 3.09 angstroms (see paper)
63% identity, 87% coverage: 6:73/78 of query aligns to 2:69/69 of 5usrK
P80643 Acyl carrier protein; ACP from Bacillus subtilis (strain 168) (see paper)
58% identity, 99% coverage: 1:77/78 of query aligns to 1:77/77 of P80643
2x2bA Crystal structure of malonyl-acp (acyl carrier protein) from bacillus subtilis (see paper)
59% identity, 96% coverage: 1:75/78 of query aligns to 1:75/76 of 2x2bA
>SMc00573
MSDIAERVKKIVIDHLGVDAEKVSEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA
DSILTVGDAVKFIEKAQA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory