Align Phenylalanine 4-monooxygenase (EC 1.14.16.1) (characterized)
to candidate 200831 SO1666 phenylalanine-4-hydroxylase (NCBI ptt file)
Query= reanno::MR1:200831 (271 letters) >FitnessBrowser__MR1:200831 Length = 271 Score = 556 bits (1434), Expect = e-163 Identities = 271/271 (100%), Positives = 271/271 (100%) Query: 1 MTIDTVHTAPYVARSADDSGYIHYPQEEHDIWRQLYARQAVNLPGRACKEYLQGLDALAM 60 MTIDTVHTAPYVARSADDSGYIHYPQEEHDIWRQLYARQAVNLPGRACKEYLQGLDALAM Sbjct: 1 MTIDTVHTAPYVARSADDSGYIHYPQEEHDIWRQLYARQAVNLPGRACKEYLQGLDALAM 60 Query: 61 PKDRIPQLAEIDKVLMATTGWKTADVPALISFGRFFELLANKEFPVATFIRRKEEFDYLQ 120 PKDRIPQLAEIDKVLMATTGWKTADVPALISFGRFFELLANKEFPVATFIRRKEEFDYLQ Sbjct: 61 PKDRIPQLAEIDKVLMATTGWKTADVPALISFGRFFELLANKEFPVATFIRRKEEFDYLQ 120 Query: 121 EPDIFHEIFGHCPLLTNPSFAHFSHMYGQLGLNASKEDRVFLARLYWFTVEFGLLKPQEG 180 EPDIFHEIFGHCPLLTNPSFAHFSHMYGQLGLNASKEDRVFLARLYWFTVEFGLLKPQEG Sbjct: 121 EPDIFHEIFGHCPLLTNPSFAHFSHMYGQLGLNASKEDRVFLARLYWFTVEFGLLKPQEG 180 Query: 181 ELCIYGGGILSSPGETLYAMESQVPERKPFDLLDVLRTPYRIDIMQPIYYVIEHIDVLDE 240 ELCIYGGGILSSPGETLYAMESQVPERKPFDLLDVLRTPYRIDIMQPIYYVIEHIDVLDE Sbjct: 181 ELCIYGGGILSSPGETLYAMESQVPERKPFDLLDVLRTPYRIDIMQPIYYVIEHIDVLDE 240 Query: 241 IAKMDIMAYVAKARQLGLFAPKYPPKAKKAS 271 IAKMDIMAYVAKARQLGLFAPKYPPKAKKAS Sbjct: 241 IAKMDIMAYVAKARQLGLFAPKYPPKAKKAS 271 Lambda K H 0.323 0.140 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 403 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 271 Length of database: 271 Length adjustment: 25 Effective length of query: 246 Effective length of database: 246 Effective search space: 60516 Effective search space used: 60516 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 47 (22.7 bits)
Align candidate 200831 SO1666 (phenylalanine-4-hydroxylase (NCBI ptt file))
to HMM TIGR01267 (phhA: phenylalanine-4-hydroxylase (EC 1.14.16.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01267.hmm # target sequence database: /tmp/gapView.9209.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01267 [M=248] Accession: TIGR01267 Description: Phe4hydrox_mono: phenylalanine-4-hydroxylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.6e-106 338.5 0.0 1.1e-105 338.4 0.0 1.0 1 lcl|FitnessBrowser__MR1:200831 SO1666 phenylalanine-4-hydroxyla Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__MR1:200831 SO1666 phenylalanine-4-hydroxylase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 338.4 0.0 1.1e-105 1.1e-105 3 247 .. 16 261 .. 14 262 .. 0.98 Alignments for each domain: == domain 1 score: 338.4 bits; conditional E-value: 1.1e-105 TIGR01267 3 tvaqdldryseeehavwatlidrqlkllegracdeyldGveklgldadripdleevneklraltGwkivavpglipadv 81 +++ ++++y++eeh +w+ l+ rq+ l+grac+eyl+G++ l +++drip+l e++++l+a+tGwk + vp+li + lcl|FitnessBrowser__MR1:200831 16 ADDSGYIHYPQEEHDIWRQLYARQAVNLPGRACKEYLQGLDALAMPKDRIPQLAEIDKVLMATTGWKTADVPALISFGR 94 67899************************************************************************** PP TIGR01267 82 ffehlanrrfpvttflrtpeeldylqepdvfhdlfGhvpllsnpvfadfleayGkkgvkakalgaallarlywytvefG 160 ffe+lan++fpv+tf+r +ee+dylqepd+fh++fGh+pll+np fa+f ++yG++g++a+++++++larlyw+tvefG lcl|FitnessBrowser__MR1:200831 95 FFELLANKEFPVATFIRRKEEFDYLQEPDIFHEIFGHCPLLTNPSFAHFSHMYGQLGLNASKEDRVFLARLYWFTVEFG 173 ******************************************************************************* PP TIGR01267 161 lvetaag.lriyGaGilsskkelvyaleskeplrvafdllevmrtryridklqkayfvlpslkrlfdaaqedfealvae 238 l++ ++g l iyG+Gilss+ e++ya+es+ p+r++fdll+v+rt+yrid++q++y+v++ ++ l ++a+ d++a va+ lcl|FitnessBrowser__MR1:200831 174 LLKPQEGeLCIYGGGILSSPGETLYAMESQVPERKPFDLLDVLRTPYRIDIMQPIYYVIEHIDVLDEIAKMDIMAYVAK 252 ***988879********************************************************************** PP TIGR01267 239 akdlkaldp 247 a++l++++p lcl|FitnessBrowser__MR1:200831 253 ARQLGLFAP 261 **9999887 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (248 nodes) Target sequences: 1 (271 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 11.15 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory