Align IGP synthase cyclase subunit; EC 4.1.3.- (characterized)
to candidate 201225 SO2068 hisF protein (cyclase) (NCBI ptt file)
Query= CharProtDB::CH_024847 (258 letters) >FitnessBrowser__MR1:201225 Length = 257 Score = 390 bits (1001), Expect = e-113 Identities = 190/256 (74%), Positives = 219/256 (85%) Query: 1 MLAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRV 60 MLAKRI+PCLDV+DG VVKGVQFRNHEI+GDIVPLA RYA EGADELVFYDITAS+ RV Sbjct: 1 MLAKRIVPCLDVKDGCVVKGVQFRNHEIVGDIVPLAARYAAEGADELVFYDITASAHDRV 60 Query: 61 VDKSWVSRVAEVIDIPFCVAGGIKSLEDAAKILSFGADKISINSPALADPTLITRLADRF 120 VDKSWVSRVAE IDIPFCVAGGIK++ A ++L+FGADKIS+NSPAL+DP+LI+RL D F Sbjct: 61 VDKSWVSRVAEQIDIPFCVAGGIKTITQARELLAFGADKISVNSPALSDPSLISRLQDEF 120 Query: 121 GVQCIVVGIDTWYDAETGKYHVNQYTGDESRTRVTQWETLDWVQEVQKRGAGEIVLNMMN 180 G QCIV+GID++YDA + Y V Q+TGDE+ T+ T W T DWV+EVQKRG GEIVLN+MN Sbjct: 121 GRQCIVIGIDSFYDAASDSYKVKQFTGDEAATKETAWYTQDWVEEVQKRGCGEIVLNVMN 180 Query: 181 QDGVRNGYDLEQLKKVREVCHVPLIASGGAGTMEHFLEAFRDADVDGALAASVFHKQIIN 240 QDGVR GYD++QL VR++C VPLIASGGAGTM HF + F DA VD ALAASVFHK IIN Sbjct: 181 QDGVRGGYDIKQLSLVRQLCDVPLIASGGAGTMAHFRDVFIDAKVDAALAASVFHKAIIN 240 Query: 241 IGELKAYLATQGVEIR 256 IGELK YLA +G+ IR Sbjct: 241 IGELKQYLAAEGIAIR 256 Lambda K H 0.321 0.138 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 319 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 257 Length adjustment: 24 Effective length of query: 234 Effective length of database: 233 Effective search space: 54522 Effective search space used: 54522 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate 201225 SO2068 (hisF protein (cyclase) (NCBI ptt file))
to HMM TIGR00735 (hisF: imidazoleglycerol phosphate synthase, cyclase subunit)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00735.hmm # target sequence database: /tmp/gapView.10085.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00735 [M=254] Accession: TIGR00735 Description: hisF: imidazoleglycerol phosphate synthase, cyclase subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-108 347.0 2.0 3e-108 346.9 2.0 1.0 1 lcl|FitnessBrowser__MR1:201225 SO2068 hisF protein (cyclase) (N Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__MR1:201225 SO2068 hisF protein (cyclase) (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 346.9 2.0 3e-108 3e-108 1 254 [] 1 256 [. 1 256 [. 0.98 Alignments for each domain: == domain 1 score: 346.9 bits; conditional E-value: 3e-108 TIGR00735 1 mlakriipCLdvkdgrvvkGvqfknlrdaGdpvelakkydeeGadelvflditassekretmlevvervaekvfiPltv 79 mlakri+pCLdvkdg vvkGvqf+n++ +Gd+v+la++y++eGadelvf+ditas+++r +++++v+rvae+++iP++v lcl|FitnessBrowser__MR1:201225 1 MLAKRIVPCLDVKDGCVVKGVQFRNHEIVGDIVPLAARYAAEGADELVFYDITASAHDRVVDKSWVSRVAEQIDIPFCV 79 8****************************************************************************** PP TIGR00735 80 gGGiksiedvkkllraGadkvsintaavkapelikeladrfGsqaivvaidakreaeneeakyevtikgGres....td 154 +GGik+i+++++ll++Gadk+s+n++a+ +p li++l d fG+q+iv++id+ ++a ++ +y+v++ +G+e t lcl|FitnessBrowser__MR1:201225 80 AGGIKTITQARELLAFGADKISVNSPALSDPSLISRLQDEFGRQCIVIGIDSFYDAASD--SYKVKQFTGDEAatkeTA 156 ******************************************************99875..9********997666689 PP TIGR00735 155 ldvvewakeveelGaGeilltsmdkdGtksGydlellkkvkeavkiPviasgGaGkaehleeaflkgkadaaLaasvfh 233 + + +w++ev+++G Gei+l++m++dG++ Gyd+++l v++ +++P+iasgGaG++ h++++f+++k+daaLaasvfh lcl|FitnessBrowser__MR1:201225 157 WYTQDWVEEVQKRGCGEIVLNVMNQDGVRGGYDIKQLSLVRQLCDVPLIASGGAGTMAHFRDVFIDAKVDAALAASVFH 235 9999*************************************************************************** PP TIGR00735 234 kreltieevkeylaergvkvr 254 k +++i+e+k+yla++g+ +r lcl|FitnessBrowser__MR1:201225 236 KAIINIGELKQYLAAEGIAIR 256 *******************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (254 nodes) Target sequences: 1 (257 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 7.50 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory