Align 3-isopropylmalate dehydratase small subunit 1; Alpha-IPM isomerase 1; IPMI 1; Isopropylmalate isomerase 1; EC 4.2.1.33 (characterized)
to candidate 203314 SO4233 3-isopropylmalate dehydratase, small subunit (NCBI ptt file)
Query= SwissProt::P04787 (201 letters) >FitnessBrowser__MR1:203314 Length = 201 Score = 244 bits (623), Expect = 8e-70 Identities = 120/200 (60%), Positives = 145/200 (72%), Gaps = 1/200 (0%) Query: 3 EKFTQHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFNDWRFLDEKGQQPNPEFV 62 + FT HTGL V +D+AN+DTD IIPKQFL KVTR GFG HLF+DWR+LD+ G PNPEF Sbjct: 2 QPFTCHTGLAVMIDSANIDTDQIIPKQFLSKVTRDGFGVHLFHDWRYLDDAGDVPNPEFT 61 Query: 63 LNFPEYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAPSFADIFYGNSFNNQLLPV 122 LN P Y GASILLA+ENFGCGSSREHAPWAL D+G + +IAPSFADIFYGNS NN LLPV Sbjct: 62 LNKPRYNGASILLAQENFGCGSSREHAPWALADFGLRAIIAPSFADIFYGNSINNGLLPV 121 Query: 123 TLSDAQVDELFALVKANPGIKFEVDL-EAQVVKAGDKTYSFKIDDFRRHCMLNGLDSIGL 181 LS +V +L V + G + VDL QV +SF + + RH +LNGLD+IGL Sbjct: 122 KLSANEVRQLMDEVASEEGAQITVDLTTCQVTSPSGAQFSFSLAESARHKLLNGLDAIGL 181 Query: 182 TLQHEDAIAAYENKQPAFMR 201 TL H I+ YE++ P++ R Sbjct: 182 TLSHGAQISEYESQIPSWRR 201 Lambda K H 0.321 0.138 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 201 Length of database: 201 Length adjustment: 21 Effective length of query: 180 Effective length of database: 180 Effective search space: 32400 Effective search space used: 32400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate 203314 SO4233 (3-isopropylmalate dehydratase, small subunit (NCBI ptt file))
to HMM TIGR00171 (leuD: 3-isopropylmalate dehydratase, small subunit (EC 4.2.1.33))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00171.hmm # target sequence database: /tmp/gapView.11052.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00171 [M=188] Accession: TIGR00171 Description: leuD: 3-isopropylmalate dehydratase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-86 273.2 0.0 6.5e-86 273.0 0.0 1.0 1 lcl|FitnessBrowser__MR1:203314 SO4233 3-isopropylmalate dehydra Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__MR1:203314 SO4233 3-isopropylmalate dehydratase, small subunit (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 273.0 0.0 6.5e-86 6.5e-86 1 188 [] 1 189 [. 1 189 [. 0.99 Alignments for each domain: == domain 1 score: 273.0 bits; conditional E-value: 6.5e-86 TIGR00171 1 mkefkkltGlvvpldkanvdtdaiipkqflkkikrtGfgkhlfyewryldekGkepnpefvlnvpqyqgasillarenf 79 m++f +tGl+v +d an+dtd+iipkqfl k++r Gfg hlf++wryld+ G+ pnpef ln p+y+gasilla+enf lcl|FitnessBrowser__MR1:203314 1 MQPFTCHTGLAVMIDSANIDTDQIIPKQFLSKVTRDGFGVHLFHDWRYLDDAGDVPNPEFTLNKPRYNGASILLAQENF 79 89***************************************************************************** PP TIGR00171 80 GcGssrehapwalkdyGfkviiapsfadifynnsfkngllpirlseeeveellalvk.nkglkltvdleaqkvkdsegk 157 GcGssrehapwal+d+G++ iiapsfadify+ns++ngllp++ls +ev++l+ v+ ++g ++tvdl + +v++ g lcl|FitnessBrowser__MR1:203314 80 GCGSSREHAPWALADFGLRAIIAPSFADIFYGNSINNGLLPVKLSANEVRQLMDEVAsEEGAQITVDLTTCQVTSPSGA 158 ********************************************************9899******************* PP TIGR00171 158 vysfeidefrkhcllnGldeigltlqkedei 188 + sf + e +h llnGld igltl + +i lcl|FitnessBrowser__MR1:203314 159 QFSFSLAESARHKLLNGLDAIGLTLSHGAQI 189 *************************997665 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (188 nodes) Target sequences: 1 (201 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 5.69 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory