Align Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 (uncharacterized)
to candidate 208063 DVU2566 diaminopimelate decarboxylase
Query= curated2:O27390 (428 letters) >MicrobesOnline__882:208063 Length = 421 Score = 291 bits (745), Expect = 3e-83 Identities = 173/408 (42%), Positives = 242/408 (59%), Gaps = 17/408 (4%) Query: 16 GGADAVELADEYGTPLYVIDEMRIRENYRRLYRAFSGEYSRFQVFYACKANTNLAVMRIL 75 G EL + YG+PLYV E +R+ R + +A S + F+V Y+ KAN+NLA++ I+ Sbjct: 16 GLTSPTELVETYGSPLYVYSEAILRQRCREM-KALSS-HPGFRVNYSAKANSNLALLHII 73 Query: 76 EEEGSGIDAVSPGEIYTALMAGFDPDRILYTGNNVRDDELQFALDSGVRINVDSRSQLLR 135 EEG +DA+SPGE++ L AGF PD+ILY NNV +EL A+ G+ ++VDS SQL Sbjct: 74 REEGLVVDAMSPGELFMNLRAGFSPDKILYVCNNVSAEELGNAVSHGLLVSVDSLSQLDL 133 Query: 136 LSEIAPEGLRISFRVNPLVGAGHHEHCITGGEMSKFGVMEREAPEVYRMAMDLGFEPVGI 195 E+ P G R+ R NP +GAGHH+ +T G+ +KFGV EV + GI Sbjct: 134 YGEVNPGG-RVMVRFNPGIGAGHHKKVVTAGKETKFGVDPASIDEVRTILARHNLTLAGI 192 Query: 196 HAHIGSGILDPEPFMLAVETLMDIAGRVHEATGVEFEFIDFGGGLGIPYTP-EEEP-LDI 253 + HIGS L+PE ++ A L+ +A R + E IDFGGG GIPY + +P LD+ Sbjct: 193 NQHIGSLFLEPESYVEAARFLLTLAERFDDV-----EVIDFGGGFGIPYHKYDNQPRLDL 247 Query: 254 DEFASKITGLFKDKLSEYGLGRPMMCLEPGRYIVGDASYLLTRVNTIKES-YRKFAGVDA 312 ++ L G R +EPGRY+V + LL V+++K + ++ G D Sbjct: 248 TAMGAQFDDLISGWAQRRGY-RGRFLVEPGRYVVAECGLLLGSVHSVKSNGANRYVGTDL 306 Query: 313 GFNTLLRPAMYGSYHHILVAERPLDEPSEKM---DVAGNVCESGDLFARDRQLPEINEGD 369 GFN L RP MY ++H I V R PS+ + V GN+CESGD+ AR+R LP + EGD Sbjct: 307 GFNVLARPVMYDAHHDIEV-YREDGAPSDLLLPQTVVGNICESGDIIARNRPLPPVEEGD 365 Query: 370 VLAIMNAGAYSFSMSSQYNSRPRPAEVLV-REGKVDVVRERETFSDLL 416 +L +++AGAY + MSS YN R RPAEVL+ EG+ +VR RET DL+ Sbjct: 366 ILGVLDAGAYGYVMSSSYNQRMRPAEVLIDLEGRPRLVRRRETLDDLV 413 Lambda K H 0.320 0.140 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 577 Number of extensions: 30 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 428 Length of database: 421 Length adjustment: 32 Effective length of query: 396 Effective length of database: 389 Effective search space: 154044 Effective search space used: 154044 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate 208063 DVU2566 (diaminopimelate decarboxylase)
to HMM TIGR01048 (lysA: diaminopimelate decarboxylase (EC 4.1.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01048.hmm # target sequence database: /tmp/gapView.24506.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01048 [M=417] Accession: TIGR01048 Description: lysA: diaminopimelate decarboxylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.2e-116 372.8 0.0 1.1e-115 372.4 0.0 1.0 1 lcl|MicrobesOnline__882:208063 DVU2566 diaminopimelate decarbox Domain annotation for each sequence (and alignments): >> lcl|MicrobesOnline__882:208063 DVU2566 diaminopimelate decarboxylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 372.4 0.0 1.1e-115 1.1e-115 16 414 .. 20 414 .. 9 416 .. 0.94 Alignments for each domain: == domain 1 score: 372.4 bits; conditional E-value: 1.1e-115 TIGR01048 16 lkelaeefgtPlYvydeetlrerlealkeafkaeeslvlYAvKAnsnlavlrllaeeGlgldvvsgGEleralaAgvka 94 +el+e++g+PlYvy+e+ lr+r++++k+ ++ +v Y +KAnsnla+l++++eeGl +d++s GEl + l Ag+++ lcl|MicrobesOnline__882:208063 20 PTELVETYGSPLYVYSEAILRQRCREMKALSSHPGFRVNYSAKANSNLALLHIIREEGLVVDAMSPGELFMNLRAGFSP 98 579*************************99998878******************************************* PP TIGR01048 95 ekivfsgngkseeeleaaleleiklinvdsveelelleeiakelgkkarvllRvnpdvdaktheyisTGlkesKFGiev 173 +ki++ n++s eel +a++++ ++vds+++l+l e++++ rv++R np+++a +h+++ T+ ke KFG+++ lcl|MicrobesOnline__882:208063 99 DKILYVCNNVSAEELGNAVSHGLL-VSVDSLSQLDLYGEVNPGG----RVMVRFNPGIGAGHHKKVVTAGKETKFGVDP 172 ***********************7.*******************....******************************* PP TIGR01048 174 eeaeeayelalkleslelvGihvHIGSqildlepfveaaekvvklleelkeegieleeldlGGGlgisyeeeeeapdl. 251 + + ++++l++++l+l Gi+ HIGS l+ e +veaa+ +++l+e+ ++e++d+GGG+gi+y++ +++p+l lcl|MicrobesOnline__882:208063 173 A-SIDEVRTILARHNLTLAGINQHIGSLFLEPESYVEAARFLLTLAER----FDDVEVIDFGGGFGIPYHKYDNQPRLd 246 *.8899999***************************************....5899**************998887651 PP TIGR01048 252 .eeyaeklleklekea.elglklklilEpGRslvanagvlltrVesvKevesrkfvlvDagmndliRpalYeayheiaa 328 + + +++ + +++ a + g + + ++EpGR++va+ g ll +V+svK+++ ++v D g+n l Rp++Y+a h+i + lcl|MicrobesOnline__882:208063 247 lTAMGAQFDDLISGWAqRRGYRGRFLVEPGRYVVAECGLLLGSVHSVKSNGANRYVGTDLGFNVLARPVMYDAHHDIEV 325 156667778888888889999********************************************************** PP TIGR01048 329 lkrleeeet..etvdvvGplCEsgDvlakdrelpeveeGdllavasaGAYgasmssnYnsrprpaevlve.egkarlir 404 ++ + ++ +vvG++CEsgD++a++r lp veeGd+l v +aGAYg+ mss Yn+r rpaevl++ eg+ rl+r lcl|MicrobesOnline__882:208063 326 YREDGAPSDllLPQTVVGNICESGDIIARNRPLPPVEEGDILGVLDAGAYGYVMSSSYNQRMRPAEVLIDlEGRPRLVR 404 *77444433115679******************************************************95679***** PP TIGR01048 405 rretledlla 414 rretl+dl+a lcl|MicrobesOnline__882:208063 405 RRETLDDLVA 414 ********97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (417 nodes) Target sequences: 1 (421 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 6.97 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory