Align N-(5'-phosphoribosyl)anthranilate isomerase; PRAI; EC 5.3.1.24 (uncharacterized)
to candidate 209405 DVU0469 N-(5-phosphoribosyl)anthranilate isomerase (TIGR)
Query= curated2:Q8PJ26 (222 letters) >FitnessBrowser__DvH:209405 Length = 284 Score = 115 bits (288), Expect = 8e-31 Identities = 90/246 (36%), Positives = 116/246 (47%), Gaps = 37/246 (15%) Query: 7 RTRIKFCGMTRAGDIRLAGELGVDAVGFIFAHGSPRRVAPAEARAMRQATAPMVDVVALF 66 R R+K CG+TR D LGV GFIF SPR V PA M T M+ V +F Sbjct: 35 RLRVKVCGLTRQEDAASCARLGVHLGGFIFHASSPRNVDPACVADMD--TGRMLRV-GVF 91 Query: 67 RNNSKEEVREVVRTVRPTLLQFHGEEDDAFCRSFNLPYLKAVPMGSSGVN----GEDAN- 121 S +EV +R R + Q HG +D AFC+ +P SG++ GE A+ Sbjct: 92 VRQSVDEVVRTMRVARLHMAQLHGGQDVAFCKELVAALADILPEVLSGMSPSSGGEHADS 151 Query: 122 ------------------ARTLQLSY------PNTAGFLFDSHAPGAGGGTGKTFDWSRL 157 A T+ + P F+FD A AGGG G T W L Sbjct: 152 PHDMARGRLLRAVWPARHATTVSFEHELATLAPYVGHFVFD--AGTAGGGHGATLPWDAL 209 Query: 158 P-TGLHRPFLLAGGINADNVFDAIVATLPWGVDVSSGVELAPGIKDGHKMRKFVEEVRRA 216 RP+LLAGG+ DNV A+ A PWGVD++SGVE APGIKD ++ + V A Sbjct: 210 EGMSCPRPWLLAGGLGPDNVERAVRACHPWGVDLNSGVESAPGIKDMQRIENAL--VALA 267 Query: 217 DCHEMS 222 C ++S Sbjct: 268 ACGDVS 273 Lambda K H 0.321 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 216 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 222 Length of database: 284 Length adjustment: 24 Effective length of query: 198 Effective length of database: 260 Effective search space: 51480 Effective search space used: 51480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory