Align Probable 2-isopropylmalate synthase; EC 2.3.3.13; Alpha-IPM synthase; Alpha-isopropylmalate synthase (uncharacterized)
to candidate 408370 DVUA0016 homocitrate synthase (TIGR)
Query= curated2:Q8ZW35 (384 letters) >FitnessBrowser__DvH:408370 Length = 384 Score = 193 bits (490), Expect = 8e-54 Identities = 116/350 (33%), Positives = 189/350 (54%), Gaps = 5/350 (1%) Query: 8 IKIFDTTLRDGEQMPGVALSISEKLEIAMALDDAGVDMIEAGFAAVSDDEKEAIKLISKE 67 + + D+TLR+G Q GV +++ I + +GV EAG+A DD ++L ++ Sbjct: 22 VMLIDSTLREGAQAYGVYFDAADRESILQGVAASGVTEAEAGWAG-QDDLAATLRLGARV 80 Query: 68 VSRAKVVSLARMTKSDVDAAAEADVDMIHLFIATSDIHLKYKLGITREEALRRIEEVVSY 127 ++ R +D+D AAEA +H+ + +SD H++ +LG+ R+E L+R+ V+ + Sbjct: 81 APSLRLAVWCRCCTADLDKAAEAGARRVHIGVPSSDAHMRLRLGMGRDEVLQRVTTVLEH 140 Query: 128 AKSYG-VEILFSAEDATRSDLEFLAKAYKTAIEAGADEINVPDTVGVMTPSRMAYLIKYL 186 A G + + EDA R+ + L +TA GA + DTVG++TP M L+ L Sbjct: 141 AAHLGFLHVTLGLEDAGRAAPDLLEALARTAARTGAHRLRCSDTVGLLTPDGMVRLV-LL 199 Query: 187 RERLPPIPMHVHCHDDFGMAVANTVTAIENGADVAQVVVNNFGERAGNAALEEVVAAVHY 246 R +P+ VHCH+D G+A AN + A++ GAD A V + GERAG EE+ AA+ Sbjct: 200 ARRASALPVAVHCHNDLGLATANALAALDAGADGADVSLLGLGERAGITRAEELAAALVV 259 Query: 247 LLGLRTNIKLEKLYSLSQLVSKLFGVPVPPNKAVVGENAFSHEAGIHVHGVLNNPFTYEP 306 L G + +L+ L + + ++ + +PP+ AV GEN F+ E+G+H+HGV +P +EP Sbjct: 260 LRG--ESYRLDMLRGVCRRLAASLEMRLPPHWAVAGENLFAVESGVHLHGVQRDPALFEP 317 Query: 307 MRPEDVGNRRRIVLGKHSGRHSVIWALKNLGVEPSEDLVNYVLDAVKKLA 356 P VG RR+ +G G V + G+ D + + AV+ A Sbjct: 318 FPPALVGAERRLGVGGKCGSAGVAAMAHSHGLTLQGDALRRHVRAVRDKA 367 Lambda K H 0.317 0.133 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 357 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 384 Length adjustment: 30 Effective length of query: 354 Effective length of database: 354 Effective search space: 125316 Effective search space used: 125316 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory