Align ATP phosphoribosyltransferase (characterized)
to candidate 5209744 Shew_2197 ATP phosphoribosyltransferase (RefSeq)
Query= CharProtDB::CH_024688 (299 letters) >FitnessBrowser__PV4:5209744 Length = 299 Score = 405 bits (1042), Expect = e-118 Identities = 202/298 (67%), Positives = 244/298 (81%) Query: 1 MTDNTRLRIAMQKSGRLSDDSRELLARCGIKINLHTQRLIAMAENMPIDILRVRDDDIPG 60 M+++ RLRIA+QKSGRLS +S++LL CGIK N++ QRLIA ++NMPID+LRVRDDDIPG Sbjct: 1 MSESNRLRIAIQKSGRLSKESQKLLKSCGIKFNVNEQRLIAHSDNMPIDLLRVRDDDIPG 60 Query: 61 LVMDGVVDLGIIGENVLEEELLNRRAQGEDPRYFTLRRLDFGGCRLSLATPVDEAWDGPL 120 LVMDGVVDLGIIGENVLEEE + R+ + LR+LDFG CRLSLA P + + Sbjct: 61 LVMDGVVDLGIIGENVLEEEQIERQTLDKPSECIKLRQLDFGACRLSLAVPTEFRYQDAS 120 Query: 121 SLNGKRIATSYPHLLKRYLDQKGISFKSCLLNGSVEVAPRAGLADAICDLVSTGATLEAN 180 SL G RIATSYP+LL+RY+ +KGIS++ C+L GSVEVAPRAGLAD ICDLVSTGATLEAN Sbjct: 121 SLEGLRIATSYPNLLRRYMQEKGISYRDCMLKGSVEVAPRAGLADGICDLVSTGATLEAN 180 Query: 181 GLREVEVIYRSKACLIQRDGEMEESKQQLIDKLLTRIQGVIQARESKYIMMHAPTERLDE 240 GL E EVIYRS AC+IQ E E+KQ LIDK+L+R+ GV++A+ESKYI++HAPTE LD+ Sbjct: 181 GLYETEVIYRSMACIIQSTQEQSEAKQALIDKILSRVNGVVRAKESKYILLHAPTETLDQ 240 Query: 241 VIALLPGAERPTILPLAGDQQRVAMHMVSSETLFWETMEKLKALGASSILVLPIEKMM 298 ++ALLPGAE PT+LPL D RVA+H VSSE LFW+TME L LGASSILV+PIEKMM Sbjct: 241 IVALLPGAENPTVLPLNDDTNRVAIHAVSSEDLFWDTMEALTQLGASSILVMPIEKMM 298 Lambda K H 0.320 0.137 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 333 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 299 Length adjustment: 27 Effective length of query: 272 Effective length of database: 272 Effective search space: 73984 Effective search space used: 73984 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate 5209744 Shew_2197 (ATP phosphoribosyltransferase (RefSeq))
to HMM TIGR00070 (hisG: ATP phosphoribosyltransferase (EC 2.4.2.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00070.hmm # target sequence database: /tmp/gapView.1987.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00070 [M=183] Accession: TIGR00070 Description: hisG: ATP phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-59 185.9 0.0 4.6e-59 185.5 0.0 1.2 1 lcl|FitnessBrowser__PV4:5209744 Shew_2197 ATP phosphoribosyltran Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5209744 Shew_2197 ATP phosphoribosyltransferase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 185.5 0.0 4.6e-59 4.6e-59 1 183 [] 7 197 .. 7 197 .. 0.96 Alignments for each domain: == domain 1 score: 185.5 bits; conditional E-value: 4.6e-59 TIGR00070 1 lriAlp.KGrleeetlkllekaglklskkeerkliasaedeevevlllrakdiptyvekgaadlGitGkDlleEsead 77 lriA++ Grl++e+ kll+++g+k++ +e ++lia++++ ++++l +r++dip v +g++dlGi+G+++leE++ + lcl|FitnessBrowser__PV4:5209744 7 LRIAIQkSGRLSKESQKLLKSCGIKFNVNE-QRLIAHSDNMPIDLLRVRDDDIPGLVMDGVVDLGIIGENVLEEEQIE 83 89****99********************99.99*****************************************5555 PP TIGR00070 78 .........vvelldlgfgkcklvlAvpeesdvesledlkegkriATkypnltreylekkgvkveivkleGavElapl 146 ++l +l+fg+c+l+lAvp e +++++++l+ g riAT+ypnl r+y+++kg++++ + l+G+vE+ap+ lcl|FitnessBrowser__PV4:5209744 84 rqtldkpseCIKLRQLDFGACRLSLAVPTEFRYQDASSLE-GLRIATSYPNLLRRYMQEKGISYRDCMLKGSVEVAPR 160 556778888**************************99999.9************************************ PP TIGR00070 147 lgladaIvDivetGttLrengLkiieeilessarlia 183 +glad I+D+v+tG+tL++ngL ++e+i++s a++i+ lcl|FitnessBrowser__PV4:5209744 161 AGLADGICDLVSTGATLEANGLYETEVIYRSMACIIQ 197 **********************************995 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (183 nodes) Target sequences: 1 (299 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 8.35 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory