Align Histidinol-phosphate aminotransferase; Imidazole acetol-phosphate transaminase; HPAT; HspAT; EC 2.6.1.9 (characterized)
to candidate 5209746 Shew_2199 histidinol-phosphate aminotransferase (RefSeq)
Query= SwissProt::P06986 (356 letters) >FitnessBrowser__PV4:5209746 Length = 360 Score = 286 bits (732), Expect = 6e-82 Identities = 159/351 (45%), Positives = 221/351 (62%), Gaps = 13/351 (3%) Query: 9 LARENVRNLTPYQSARRLGGNGDVWLNANEYPTAVEFQLTQQTLNRYPECQPKAVIENYA 68 LAR + L PYQSARR+GG G +W+NANE P +LNRYPECQP +I YA Sbjct: 18 LARPELLTLEPYQSARRIGGEGQIWINANESPF---INSDLDSLNRYPECQPPELITRYA 74 Query: 69 QYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSVSAETIGVECRTVP 128 +YAGV +QVL SRGADE IELLIR FC PG+D+I PTYGMY++SA+T V + + Sbjct: 75 EYAGVSNQQVLTSRGADEAIELLIRTFCIPGRDSIACFGPTYGMYAISAKTFNVGVKALR 134 Query: 129 TLDNWQLDLQGISDKLDGVKVVYVCSPNNPTGQLINPQDFRTLLELTRGKAIVVADEAYI 188 D +QL Q + ++ K+V++C+PNNPTG +I P ++ + +VV DEAYI Sbjct: 135 LDDEYQLP-QELCSQVGDAKLVFICNPNNPTGTVIAPDAIEAVIR-SLPDTLVVVDEAYI 192 Query: 189 EFCPQASLAGWLAEYPHLAILRTLSKAFALAGLRCGFTLANEEVINLLMKVIAPYPLSTP 248 EFCP S+A L +Y +L +LRTLSKAFALAG RCGF LA EVI ++M+VIAPYP+ P Sbjct: 193 EFCPDYSVASLLDKYDNLIVLRTLSKAFALAGARCGFMLATPEVIEMVMRVIAPYPVPLP 252 Query: 249 VADIAAQALSPQGIVAMRERVAQIIAEREYLIAALKEIPCVEQVFDSETNYILARFKASS 308 VA +A ALS GI M+ +VAQ+ A + L AL+E +V + N++LA F ++ Sbjct: 253 VAKLAIDALSKDGIARMQTQVAQLKANGQRLADALREAGA--RVLPAYGNFVLAYFDQAN 310 Query: 309 AV-----FKSLWDQGIILRDQNKQPSLSGCLRITVGTREESQRVIDALRAE 354 + L G++ R K P+L+ +R + + +++ +I L+A+ Sbjct: 311 EIKVGEMQARLKQTGVVAR-AYKDPALADAIRFSFASDAQTETLIAILKAD 360 Lambda K H 0.319 0.135 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 353 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 360 Length adjustment: 29 Effective length of query: 327 Effective length of database: 331 Effective search space: 108237 Effective search space used: 108237 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate 5209746 Shew_2199 (histidinol-phosphate aminotransferase (RefSeq))
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.19623.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-100 322.0 0.0 2.5e-100 321.7 0.0 1.0 1 lcl|FitnessBrowser__PV4:5209746 Shew_2199 histidinol-phosphate a Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5209746 Shew_2199 histidinol-phosphate aminotransferase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 321.7 0.0 2.5e-100 2.5e-100 1 347 [. 20 358 .. 20 359 .. 0.96 Alignments for each domain: == domain 1 score: 321.7 bits; conditional E-value: 2.5e-100 TIGR01141 1 rekikklepYqpgarelgekevvkLnsnEnPfgpsekvkealkeelkklhrYpdpqalelkealakylgveeenillg 78 r+++ lepYq+ ar++g+++ ++ n+nE+Pf +s l++l+rYp++q+ el +++a+y+gv+++++l++ lcl|FitnessBrowser__PV4:5209746 20 RPELLTLEPYQS-ARRIGGEGQIWINANESPFINS---------DLDSLNRYPECQPPELITRYAEYAGVSNQQVLTS 87 678899******.9******************999.........5789****************************** PP TIGR01141 79 nGsdelielliraflepg.davlvleptysmYevsakiagaevkevplkedgqedleavleaakekvklvflasPnnP 155 +G+de+iellir+f+ pg d+++ + pty mY++sak+ ++ vk +l+++ +l++ l + ++klvf+++PnnP lcl|FitnessBrowser__PV4:5209746 88 RGADEAIELLIRTFCIPGrDSIACFGPTYGMYAISAKTFNVGVKALRLDDEY--QLPQELCSQVGDAKLVFICNPNNP 163 **************************************************95..444444479999************ PP TIGR01141 156 tGnllkreeiekvleevedalVVvDeAYieFseeasvlellaeypnlvvlrTlSKafgLAglRvGyaianaeiieale 233 tG+++ + ie+v+ + d+lVVvDeAYieF++++sv++ll +y+nl+vlrTlSKaf+LAg R+G+++a++e+ie+++ lcl|FitnessBrowser__PV4:5209746 164 TGTVIAPDAIEAVIRSLPDTLVVVDEAYIEFCPDYSVASLLDKYDNLIVLRTLSKAFALAGARCGFMLATPEVIEMVM 241 ****************99************************************************************ PP TIGR01141 234 kvrapynvsslaleaavaalrdsd..kiektveevkkererlleelkkleglevyeSkaNFvlikvke....daeell 305 +v+apy+v+ +++++a+ al+++ ++ +v+++k++ +rl ++l++ g +v + ++NFvl+ +++ + e+ lcl|FitnessBrowser__PV4:5209746 242 RVIAPYPVPLPVAKLAIDALSKDGiaRMQTQVAQLKANGQRLADALREA-GARVLPAYGNFVLAYFDQaneiKVGEMQ 318 ***********************9999**********************.8****************98888888999 PP TIGR01141 306 eallekgiivRdlksaeglleeclRitvGtreenerllealk 347 +l++ g++ R k + l +++R + ++ ++e l+++lk lcl|FitnessBrowser__PV4:5209746 319 ARLKQTGVVARAYKD--PALADAIRFSFASDAQTETLIAILK 358 *************94..457******************9997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (360 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.31 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory