Align Pyrroline-5-carboxylate reductase; P5C reductase; P5CR; EC 1.5.1.2; PCA reductase (uncharacterized)
to candidate 5210588 Shew_3016 pyrroline-5-carboxylate reductase (RefSeq)
Query= curated2:P52053 (272 letters) >FitnessBrowser__PV4:5210588 Length = 264 Score = 194 bits (494), Expect = 1e-54 Identities = 109/262 (41%), Positives = 159/262 (60%), Gaps = 8/262 (3%) Query: 14 MVRAIVSGLVANGYPAQNITATAPSEARRLPLEQDFGIRTTSDNIQAATEADVVVLSVKP 73 M AI+ GL+ +G+ + +I APS+ R L QDF +R SDN A AD+++L+VKP Sbjct: 1 MASAIIRGLIKHGHRSAHILVCAPSQRTRSRLVQDFNVRVHSDNSAAVAFADIIILAVKP 60 Query: 74 QMMADVCKPLQAI-------DFTNKLVISIAAGINCSRLDDMLATKLNLVRVMPNTPSQL 126 ++ VC L+ + KL+ISIAAG+ + + D L + LV MPN P+ + Sbjct: 61 FIVPLVCDELRPLLGQVNNGRSEQKLLISIAAGLTHASISDKLPQNVQLVCAMPNLPTAI 120 Query: 127 GLGMSGLFAPIHVTEHDKAFAAELMEAVGKVCWVEQESGINNVIAAAGSAPAYFFLFMEA 186 G G++GLF P H+ A +LM AVG W+E E + +++A AGS+PAYFFLF+EA Sbjct: 121 GKGLTGLFVPGHLDRQAVDDAEQLMRAVGDTVWLEDEQQMASIVATAGSSPAYFFLFLEA 180 Query: 187 MQAEAIAQGFDKESARLLVQQAALGAASMVVSNPETELSTLRENVTSKGGTTAEALRTFN 246 M+ AIAQG ++A V Q+A+GA SM +++ E L+ LR VTS GTT +A+ F Sbjct: 181 MEKAAIAQGLPAKTASKAVLQSAMGAVSMAMASKE-GLANLRHQVTSPKGTTEQAVLAFQ 239 Query: 247 EHQLSDIVAKAMQAAVARAEEM 268 L +VA+AM +A RA+E+ Sbjct: 240 HGDLDALVARAMDSAARRAKEL 261 Lambda K H 0.317 0.129 0.353 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 128 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 264 Length adjustment: 25 Effective length of query: 247 Effective length of database: 239 Effective search space: 59033 Effective search space used: 59033 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate 5210588 Shew_3016 (pyrroline-5-carboxylate reductase (RefSeq))
to HMM TIGR00112 (proC: pyrroline-5-carboxylate reductase (EC 1.5.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00112.hmm # target sequence database: /tmp/gapView.26508.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00112 [M=263] Accession: TIGR00112 Description: proC: pyrroline-5-carboxylate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-71 225.8 2.3 4.2e-71 225.6 2.3 1.0 1 lcl|FitnessBrowser__PV4:5210588 Shew_3016 pyrroline-5-carboxylat Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5210588 Shew_3016 pyrroline-5-carboxylate reductase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 225.6 2.3 4.2e-71 4.2e-71 9 263 .] 1 261 [. 1 261 [. 0.98 Alignments for each domain: == domain 1 score: 225.6 bits; conditional E-value: 4.2e-71 TIGR00112 9 mgeallsgllkkgakakkeilvierseeklaalakelgvevtsdaeeavkeadvvllavKPqdleevlaelks..... 81 m++a+++gl+k+g + +++ilv+++s+ + +l+++++v+v+sd+ +av+ ad+++lavKP ++ v+ el+ lcl|FitnessBrowser__PV4:5210588 1 MASAIIRGLIKHGHR-SAHILVCAPSQRTRSRLVQDFNVRVHSDNSAAVAFADIIILAVKPFIVPLVCDELRPllgqv 77 9***********988.89****************************************************99888887 PP TIGR00112 82 .eektkeklliSilAGvtiekleqlleaekrvvRvmPNtaakvgagvtaiaassevseeqkelveellkavGkvveve 158 + ++++klliSi+AG+t + ++++l+++ ++v +mPN++ ++g+g t+++ + + + + +e+l++avG++v++e lcl|FitnessBrowser__PV4:5210588 78 nNGRSEQKLLISIAAGLTHASISDKLPQNVQLVCAMPNLPTAIGKGLTGLFVPGHLDRQAVDDAEQLMRAVGDTVWLE 155 777899************************************************************************ PP TIGR00112 159 .eklldavtalsGSgPAfvflliealadagvklGLpreeakelaaqtlkGaaklleesgehpalLkdkVtsPgGtTia 235 e+++ ++a +GS+PA++fl++ea+++a++++GLp+++a +++ q +Ga+ + + s+e a L+++VtsP+GtT + lcl|FitnessBrowser__PV4:5210588 156 dEQQMASIVATAGSSPAYFFLFLEAMEKAAIAQGLPAKTASKAVLQSAMGAVSMAMASKEGLANLRHQVTSPKGTTEQ 233 ****************************************************************************** PP TIGR00112 236 glavLeekgvrsavieaveaavkrseeL 263 ++ +++++++ + v++a+++a++r++eL lcl|FitnessBrowser__PV4:5210588 234 AVLAFQHGDLDALVARAMDSAARRAKEL 261 **************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (263 nodes) Target sequences: 1 (264 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 9.62 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory