Align Histidinol-phosphatase; HolPase; EC 3.1.3.15; Histidinol-phosphate phosphatase (uncharacterized)
to candidate AMB_RS06545 AMB_RS06545 inositol monophosphatase
Query= curated2:P56160 (259 letters) >FitnessBrowser__Magneto:AMB_RS06545 Length = 265 Score = 115 bits (287), Expect = 1e-30 Identities = 82/251 (32%), Positives = 129/251 (51%), Gaps = 7/251 (2%) Query: 5 LQLALELAEKAGK-LTLDYFGRRSLQVFSKRDDTPVTEADRNAEELIRQGISAKFPDDGL 63 L + + A KA + L DY LQV K V+ AD E+ +R + P G Sbjct: 8 LNVMMGAARKAARNLVRDYGEVEHLQVSKKGPADFVSSADIKTEKTLRAELKKARPGFGF 67 Query: 64 FGEEFDEHPSGN-GRRWIIDPIDGTRSFIHGVPLYGVMIALEVEGAMQLGVINFPALGEL 122 EE E + RWIIDPIDGT +F+HG+P + + IALE +G + GV+ P E+ Sbjct: 68 LMEEGGEIAGDDTSHRWIIDPIDGTTNFLHGIPNFCISIALERDGELFAGVVYQPLGDEM 127 Query: 123 YQAERGSGAFMNGSPVQVSAIAENSASTVVFTEKEYLLDPPSNHPVDQLRI----DAGLV 178 + AE+G+GAF+N ++VSA T++ T ++ P + +L AG+ Sbjct: 128 FHAEKGAGAFLNERRLRVSA-RRKLEDTLIATGIPFIGRPGHETFLKELGAVMPQVAGIR 186 Query: 179 RGWGDCYGHMLVASGRAEVAVDKIMSPWDCAAVIPIVEEAGGCCFDYRGRQSIIDGEGLV 238 R VA+GR + + + PWD AA I +V+EAGG D++G ++D ++ Sbjct: 187 RFGSAALDLAYVAAGRCDGYWETGIKPWDIAAGIVLVKEAGGYVTDFQGGSKMLDNGEVL 246 Query: 239 SANNAMGRNLI 249 +AN+ + + L+ Sbjct: 247 AANDHLHQPLM 257 Lambda K H 0.319 0.138 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 159 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 265 Length adjustment: 25 Effective length of query: 234 Effective length of database: 240 Effective search space: 56160 Effective search space used: 56160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory