Align isochorismate lyase (EC 4.2.99.21); isochorismate synthase (EC 5.4.4.2) (characterized)
to candidate AZOBR_RS07490 AZOBR_RS07490 anthranilate synthase subunit I
Query= BRENDA::P9WFX1 (450 letters) >FitnessBrowser__azobra:AZOBR_RS07490 Length = 503 Score = 144 bits (364), Expect = 5e-39 Identities = 87/249 (34%), Positives = 127/249 (51%), Gaps = 1/249 (0%) Query: 194 AVDEIAAGRYHKVILSRCVEVPFAIDFPLTYRLGRRHNTPVRSFLLQLGGIRALGYSPEL 253 A + I AG +V+ S+ + PF YR RR N F G + +G SPE+ Sbjct: 242 AKEYIRAGDIFQVVPSQRIRFPFKPSPLALYRTLRRLNPSPFLFHCDFGELSVVGSSPEI 301 Query: 254 VTAVRADGVVITEPLAGTRALGRGPAIDRLARDDLESNSKEIVEHAISVRSSLEEITDIA 313 + VR DG V P+AGTR G A D+ +DL S+ KE+ EH + + ++ +A Sbjct: 302 LVRVR-DGNVTVRPIAGTRKRGATAAEDQALAEDLLSDPKELAEHLMLLDLGRNDVGRVA 360 Query: 314 EPGSAAVIDFMTVRERGSVQHLGSTIRARLDPSSDRMAALEALFPAVTASGIPKAAGVEA 373 G+ V M V V H+ S + LDP D + AL A FPA T SG PK ++ Sbjct: 361 RTGTVKVTQKMIVELYSHVMHIVSNVEGDLDPKHDALDALIAGFPAGTVSGAPKVRAMQI 420 Query: 374 IFRLDECPRGLYSGAVVMLSADGGLDAALTLRAAYQVGGRTWLRAGAGIIEESEPEREFE 433 I L++ RG+Y+G V A G +D + LR A G +++AG G++ +S+PE E++ Sbjct: 421 IDELEKARRGVYAGCVGYFGASGAMDTCIALRTAVLKDGMMYVQAGGGVVADSDPEAEYQ 480 Query: 434 ETCEKLSTL 442 ET K L Sbjct: 481 ETVNKSMAL 489 Lambda K H 0.319 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 493 Number of extensions: 36 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 450 Length of database: 503 Length adjustment: 33 Effective length of query: 417 Effective length of database: 470 Effective search space: 195990 Effective search space used: 195990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory