Align Phosphoserine phosphatase; PSP; PSPase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 (characterized)
to candidate Ac3H11_1039 Phosphoserine phosphatase (EC 3.1.3.3)
Query= SwissProt::Q12A06 (236 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1039 Length = 259 Score = 341 bits (875), Expect = 7e-99 Identities = 174/233 (74%), Positives = 195/233 (83%) Query: 4 TEISPGLVVNVATPDLKLSDFKLIAFDMDSTLINIECVDEIADAAGRKAEVAAITEAAMR 63 TE +PGLVV TP L LS +KLIAFDMDSTLINIECVDEIADAAGRKAEVAAITEAAM+ Sbjct: 27 TEFAPGLVVQGITPPLSLSAYKLIAFDMDSTLINIECVDEIADAAGRKAEVAAITEAAMQ 86 Query: 64 GEISDYKESLRQRVALLKGVSVASMDEVYRTRLRLNPGAARLVQACKDAGLKVLLVSGGF 123 G I+DYKESLRQRVALLKGV+V M++V+ RLR NPGA L+ A K AGL LLVSGGF Sbjct: 87 GVITDYKESLRQRVALLKGVTVQHMEQVFTERLRFNPGAQELITAAKAAGLTTLLVSGGF 146 Query: 124 TFFTDRIRDELGIDYTRSNVLETTDGLLTGRMVDQPWGDICDGEEKRKMLLETCGQLGIS 183 TFF DR++ LGID+ RSN+LE DG LTGRMVDQ WGDICDG EKR+ LLE +GIS Sbjct: 147 TFFADRVKAGLGIDFARSNMLEVQDGQLTGRMVDQAWGDICDGAEKRRTLLEVASLMGIS 206 Query: 184 PRQAIAMGDGANDLPMMGEAGLSVAYHAKPRVREQAMVAINEGGLDRLLELVK 236 P+QAIA+GDGANDLPMMG AGLSVAYHAKP VR QA VAIN+GGLDRLLE+++ Sbjct: 207 PQQAIAVGDGANDLPMMGAAGLSVAYHAKPTVRAQAKVAINQGGLDRLLEVLR 259 Lambda K H 0.319 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 243 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 259 Length adjustment: 24 Effective length of query: 212 Effective length of database: 235 Effective search space: 49820 Effective search space used: 49820 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
Align candidate Ac3H11_1039 (Phosphoserine phosphatase (EC 3.1.3.3))
to HMM TIGR00338 (serB: phosphoserine phosphatase SerB (EC 3.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00338.hmm # target sequence database: /tmp/gapView.20393.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00338 [M=219] Accession: TIGR00338 Description: serB: phosphoserine phosphatase SerB Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-70 222.2 0.1 3.9e-70 221.9 0.1 1.0 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1039 Phosphoserine phosphatase (EC 3. Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1039 Phosphoserine phosphatase (EC 3.1.3.3) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 221.9 0.1 3.9e-70 3.9e-70 12 219 .] 45 258 .. 39 258 .. 0.95 Alignments for each domain: == domain 1 score: 221.9 bits; conditional E-value: 3.9e-70 TIGR00338 12 kkkklvvfDlDstlieeEvIdeiaklaGveeeVseiTerAmrgel.dFkeslreRvkllkgl 72 ++ kl+ fD+Dstli++E++deia +aG + eV++iTe Am+g + d+keslr+Rv+llkg+ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1039 45 SAYKLIAFDMDSTLINIECVDEIADAAGRKAEVAAITEAAMQGVItDYKESLRQRVALLKGV 106 5679***************************************8659*************** PP TIGR00338 73 pvellkkv.eeklelteGveelvkkLkekgykvaviSGgFdlvaeklkekLgldavfaNrLe 133 v+++++v +e+l+ +G++el+ + k +g+ + ++SGgF+++a+++k+ Lg+d++ +N Le lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1039 107 TVQHMEQVfTERLRFNPGAQELITAAKAAGLTTLLVSGGFTFFADRVKAGLGIDFARSNMLE 168 ***998884689************************************************** PP TIGR00338 134 vedgkltGkve....geivdesakaktllkllekegislektvavGDGanDlsmikaAglgi 191 v+dg+ltG++ g+i d +k +tll+++ gis+++ +avGDGanDl+m+ aAgl + lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1039 169 VQDGQLTGRMVdqawGDICDGAEKRRTLLEVASLMGISPQQAIAVGDGANDLPMMGAAGLSV 230 ********864334499********************************************* PP TIGR00338 192 afnakpvlkekadiviekkdltdilell 219 a++akp ++ +a+++i++ l +le+l lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1039 231 AYHAKPTVRAQAKVAINQGGLDRLLEVL 258 *********************9999886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (219 nodes) Target sequences: 1 (259 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 7.75 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory