Align imidazole glycerol-phosphate synthase (subunit 2/2) (EC 4.3.2.10) (characterized)
to candidate Ac3H11_4733 Imidazole glycerol phosphate synthase cyclase subunit (EC 4.1.3.-)
Query= BRENDA::Q5NMD6 (255 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4733 Length = 250 Score = 278 bits (711), Expect = 8e-80 Identities = 139/249 (55%), Positives = 183/249 (73%), Gaps = 15/249 (6%) Query: 18 VVKGVNFTDLMDAGDPVEQAKVYDAAGADELCFLDISASHEGRGTMLDVVARTAEVCFMP 77 VVKGVNF +L DAGDPVE A Y+A GADEL FLDI+A+ +GR +L ++ A F+P Sbjct: 1 VVKGVNFVELRDAGDPVEIAARYNAQGADELTFLDITATSDGRDLILHIIEAVASQVFIP 60 Query: 78 LTVGGGVRQVEDARALLLAGADKVAVNSAAVARPELVAEIADRFGAQCVVAAIDARRN-- 135 LTVGGGVR VED R LL AGADK + NSAA+A P+L+ ++ ++GAQC+V AIDA+R Sbjct: 61 LTVGGGVRTVEDVRRLLNAGADKTSFNSAAIANPDLINAVSAKYGAQCIVVAIDAKRRSA 120 Query: 136 -------------GDHWEVYTHGGRRPTGINALDHALNLTRLGAGEILLTSMDKDGTRDG 182 G+ W+VY+HGGR+ TG++A+ A + R GAGEILLTSMD+DGT+ G Sbjct: 121 EDALRIGANGQPVGEGWDVYSHGGRKNTGLDAIAWATEMARRGAGEILLTSMDRDGTKSG 180 Query: 183 YDLELTRLVADSVPVPVIASGGVGNLDHMVEGVTKGHASALLAASIFHFGQYSLAEAHEA 242 +DL LTR V+D+V VPVIASGGVGNLDH+ +GV +G A A+LAASIFH+G+Y++ +A Sbjct: 181 FDLALTRAVSDAVSVPVIASGGVGNLDHLADGVQQGGADAVLAASIFHYGEYTVGQAKAR 240 Query: 243 LAKAGLTVR 251 +A+ G+ VR Sbjct: 241 MAERGIPVR 249 Lambda K H 0.320 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 251 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 250 Length adjustment: 24 Effective length of query: 231 Effective length of database: 226 Effective search space: 52206 Effective search space used: 52206 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
Align candidate Ac3H11_4733 (Imidazole glycerol phosphate synthase cyclase subunit (EC 4.1.3.-))
to HMM TIGR00735 (hisF: imidazoleglycerol phosphate synthase, cyclase subunit)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00735.hmm # target sequence database: /tmp/gapView.21738.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00735 [M=254] Accession: TIGR00735 Description: hisF: imidazoleglycerol phosphate synthase, cyclase subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-105 337.4 1.9 2.7e-105 337.2 1.9 1.0 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4733 Imidazole glycerol phosphate syn Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4733 Imidazole glycerol phosphate synthase cyclase subunit (EC 4.1.3.-) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 337.2 1.9 2.7e-105 2.7e-105 17 254 .] 1 249 [. 1 249 [. 0.99 Alignments for each domain: == domain 1 score: 337.2 bits; conditional E-value: 2.7e-105 TIGR00735 17 vvkGvqfknlrdaGdpvelakkydeeGadelvflditassekretmlevvervaekvfiPlt 78 vvkGv+f +lrdaGdpve+a++y+++Gadel+fldita+s++r+ +l+++e va +vfiPlt lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4733 1 VVKGVNFVELRDAGDPVEIAARYNAQGADELTFLDITATSDGRDLILHIIEAVASQVFIPLT 62 8************************************************************* PP TIGR00735 79 vgGGiksiedvkkllraGadkvsintaavkapelikeladrfGsqaivvaidakreaenee. 139 vgGG++++edv++ll+aGadk s n+aa+++p+li+ ++ ++G+q+ivvaidakr+ +++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4733 63 VGGGVRTVEDVRRLLNAGADKTSFNSAAIANPDLINAVSAKYGAQCIVVAIDAKRRSAEDAl 124 *********************************************************9988* PP TIGR00735 140 ..........akyevtikgGrestdldvvewakeveelGaGeilltsmdkdGtksGydlell 191 ++v+ +gGr++t+ld+++wa+e++++GaGeilltsmd+dGtksG+dl+l+ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4733 125 rigangqpvgEGWDVYSHGGRKNTGLDAIAWATEMARRGAGEILLTSMDRDGTKSGFDLALT 186 *********999************************************************** PP TIGR00735 192 kkvkeavkiPviasgGaGkaehleeaflkgkadaaLaasvfhkreltieevkeylaergvkv 253 ++v++av++PviasgG+G+ +hl++++++g ada+Laas+fh++e+t+++ k+ +aerg++v lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4733 187 RAVSDAVSVPVIASGGVGNLDHLADGVQQGGADAVLAASIFHYGEYTVGQAKARMAERGIPV 248 ************************************************************** PP TIGR00735 254 r 254 r lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4733 249 R 249 9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (254 nodes) Target sequences: 1 (250 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.09 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory