Align Ornithine carbamoyltransferase (EC 2.1.3.3) (characterized)
to candidate BPHYT_RS15915 BPHYT_RS15915 ornithine carbamoyltransferase
Query= reanno::HerbieS:HSERO_RS07185 (304 letters) >FitnessBrowser__BFirm:BPHYT_RS15915 Length = 309 Score = 453 bits (1166), Expect = e-132 Identities = 213/303 (70%), Positives = 259/303 (85%), Gaps = 1/303 (0%) Query: 3 IKHYLQFSDFTLDEYEYVIERSRVIKRKFKNYEPHHTLADRTLVMVFEKNSTRTRLSFEA 62 I+HYLQF DF+L++YEYV+ER+R++KRKFKNYE +H L DRTL M+FEKNSTRTRLSFEA Sbjct: 6 IRHYLQFKDFSLEDYEYVLERARILKRKFKNYETYHPLHDRTLAMIFEKNSTRTRLSFEA 65 Query: 63 GMHQMGGAAIYLNTRDSQLGRGEPVEDAAQVMSRMCDVIMIRTYGQEIIERFAKHSRVPV 122 G+ Q+GG A++++TRD+QLGRGEP+EDAAQV+SRM D+IMIRT+GQ+I++RF+++SRVPV Sbjct: 66 GIFQLGGHAVFMSTRDTQLGRGEPIEDAAQVISRMVDIIMIRTFGQDILQRFSENSRVPV 125 Query: 123 INGLTNEQHPCQVLADVFTYIEHHGSIQGKIVAWVGDANNMLYSWLQAAEVFGFHVNVST 182 INGLTNE HPCQVLAD+FTY EH G I+ K VAWVGDANNMLY+W++AA++ GF + +ST Sbjct: 126 INGLTNEYHPCQVLADIFTYFEHRGPIRDKTVAWVGDANNMLYTWIEAAQILGFKLRLST 185 Query: 183 PKGYDIDPAQVSPGNKN-YTFFADPADACQDADLVTTDVWTSMGFEAENNARLKAFDGWI 241 P GY +D A V+ + Y F DP +AC ADLVTTDVWTSMGFEAEN AR KAF W Sbjct: 186 PPGYKLDRAMVAAESAPFYEEFDDPNEACTGADLVTTDVWTSMGFEAENEARKKAFADWC 245 Query: 242 VDQAKMARAKKDALFMHCLPAHRGEEVAAEVIDGPQSVVWEEAENRLHVQKALLEYLVHG 301 VD MARA DALFMHCLPAHRGEEV+AEVIDGPQSVVW+EAENRLHVQKAL+EYL+ G Sbjct: 246 VDADMMARANPDALFMHCLPAHRGEEVSAEVIDGPQSVVWDEAENRLHVQKALMEYLLLG 305 Query: 302 RFD 304 + + Sbjct: 306 KLN 308 Lambda K H 0.321 0.135 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 375 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 304 Length of database: 309 Length adjustment: 27 Effective length of query: 277 Effective length of database: 282 Effective search space: 78114 Effective search space used: 78114 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate BPHYT_RS15915 BPHYT_RS15915 (ornithine carbamoyltransferase)
to HMM TIGR00658 (argF: ornithine carbamoyltransferase (EC 2.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00658.hmm # target sequence database: /tmp/gapView.28001.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00658 [M=304] Accession: TIGR00658 Description: orni_carb_tr: ornithine carbamoyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-111 357.8 0.0 2.8e-111 357.5 0.0 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS15915 BPHYT_RS15915 ornithine carbamoy Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS15915 BPHYT_RS15915 ornithine carbamoyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 357.5 0.0 2.8e-111 2.8e-111 1 303 [. 7 303 .. 7 304 .. 0.98 Alignments for each domain: == domain 1 score: 357.5 bits; conditional E-value: 2.8e-111 TIGR00658 1 rhllslldlseeelkellelakklkkekkkgkeekklkgktlaliFekrstRtRvsfevaayelGaqvly 70 rh+l+++d+s e+ +++le+a+ lk++ k+ ++ + l+ +tla+iFek+stRtR+sfe+++++lG+++++ lcl|FitnessBrowser__BFirm:BPHYT_RS15915 7 RHYLQFKDFSLEDYEYVLERARILKRKFKNYETYHPLHDRTLAMIFEKNSTRTRLSFEAGIFQLGGHAVF 76 89*****************************9************************************** PP TIGR00658 71 lnkeelqlgrkesikDtarvlsryvdaivvRvykhedveelakyasvPvingLtdlehPcqilaDlltik 140 +++ ++qlgr+e+i+D a+v+sr+vd+i++R++ +++++ +++++ vPvingLt++ hPcq+laD++t lcl|FitnessBrowser__BFirm:BPHYT_RS15915 77 MSTRDTQLGRGEPIEDAAQVISRMVDIIMIRTFGQDILQRFSENSRVPVINGLTNEYHPCQVLADIFTYF 146 ********************************************************************** PP TIGR00658 141 eklgklkevklvyvGDannvanslllaaaklGldvvvatPeglepeaeivkkakkiakenggkleltedp 210 e+ g + + ++++vGDann+ + + aa lG++++++tP+g++ + ++v +e+ e +dp lcl|FitnessBrowser__BFirm:BPHYT_RS15915 147 EHRGPIRDKTVAWVGDANNMLYTWIEAAQILGFKLRLSTPPGYKLDRAMVA------AESAPFYEEFDDP 210 ********************************************9988764......45666778899** PP TIGR00658 211 kkavkdadviytDvwvsmGeeekkeerlkllkpyqvneellelakpevkflhCLPavrGeevtdevlege 280 ++a ++ad++ tDvw+smG e+++e+r k++ ++ v+ ++++ a+p++ f+hCLPa+rGeev+ ev++g+ lcl|FitnessBrowser__BFirm:BPHYT_RS15915 211 NEACTGADLVTTDVWTSMGFEAENEARKKAFADWCVDADMMARANPDALFMHCLPAHRGEEVSAEVIDGP 280 ********************************************************************** PP TIGR00658 281 asivfdeaenRlhaqkavlkall 303 +s+v+deaenRlh+qka++++ll lcl|FitnessBrowser__BFirm:BPHYT_RS15915 281 QSVVWDEAENRLHVQKALMEYLL 303 *******************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (309 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.64 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory