Align Ornithine carbamoyltransferase, catabolic; OTCase; EC 2.1.3.3 (characterized)
to candidate BPHYT_RS27685 BPHYT_RS27685 ornithine carbamoyltransferase
Query= SwissProt::P08308 (336 letters) >FitnessBrowser__BFirm:BPHYT_RS27685 Length = 332 Score = 454 bits (1168), Expect = e-132 Identities = 218/334 (65%), Positives = 271/334 (81%), Gaps = 2/334 (0%) Query: 1 MAFNMHNRNLLSLMHHSTRELRYLLDLSRDLKRAKYTGTEQQHLKRKNIALIFEKTSTRT 60 MAFN+HNR+LL++ S R++ +LLDL+ +LKRAKY G E L KN+ALIFEKTSTRT Sbjct: 1 MAFNLHNRSLLNMQDFSPRDIGFLLDLAAELKRAKYAGNEVPRLNGKNVALIFEKTSTRT 60 Query: 61 RCAFEVAAYDQGANVTYIDPNSSQIGHKESMKDTARVLGRMYDAIEYRGFKQEIVEELAK 120 RCAFEVA +DQG +VTYID SSQ+G KES+KDTARVLGR+YD IEYRGF Q +VE+LA Sbjct: 61 RCAFEVAVHDQGGHVTYIDSASSQLGRKESLKDTARVLGRLYDGIEYRGFHQSVVEDLAA 120 Query: 121 FAGVPVFNGLTDEYHPTQMLADVLTMREHSDKPLHDISYAYLGDARNNMGNSLLLIGAKL 180 ++ VPV+NGLTDE+HPTQ+LAD+LTMRE +KPLH++S+ YLGDAR NMGNSLL+ G ++ Sbjct: 121 YSHVPVWNGLTDEFHPTQVLADLLTMREFGEKPLHELSFCYLGDARFNMGNSLLIGGVQM 180 Query: 181 GMDVRIAAPKALWPHDEFVAQCKKFAEESGAKLTLTEDPKEAVKGVDFVHTDVWVSMGEP 240 GMDVRIAAP+ LWPHDE V Q + AE +GA +T+ EDP V G DFV+TDVWVSMGEP Sbjct: 181 GMDVRIAAPRELWPHDELVQQMRHLAERTGASVTIVEDPVAGVGGADFVYTDVWVSMGEP 240 Query: 241 VEAWGERIKELLPYQVNMEIMKATGNPRAKFMHCLPAFHNSETKVGKQIAEQYPNLANGI 300 +EAWG RI LLPYQVN +MKATG R +FMHCLPA+HN ET +G+Q+ E++ + + Sbjct: 241 MEAWGPRIDLLLPYQVNAALMKATGKSRTRFMHCLPAYHNLETDIGRQLHERFG--LSEL 298 Query: 301 EVTEDVFESPYNIAFEQAENRMHTIKAILVSTLA 334 EV+++VFES +I F QAENRMHTIKA+LV+TLA Sbjct: 299 EVSDEVFESNASIVFSQAENRMHTIKAVLVATLA 332 Lambda K H 0.318 0.133 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 403 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 332 Length adjustment: 28 Effective length of query: 308 Effective length of database: 304 Effective search space: 93632 Effective search space used: 93632 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate BPHYT_RS27685 BPHYT_RS27685 (ornithine carbamoyltransferase)
to HMM TIGR00658 (argF: ornithine carbamoyltransferase (EC 2.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00658.hmm # target sequence database: /tmp/gapView.29464.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00658 [M=304] Accession: TIGR00658 Description: orni_carb_tr: ornithine carbamoyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-125 403.4 0.0 3.2e-125 403.3 0.0 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS27685 BPHYT_RS27685 ornithine carbamoy Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS27685 BPHYT_RS27685 ornithine carbamoyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 403.3 0.0 3.2e-125 3.2e-125 1 303 [. 8 331 .. 8 332 .] 0.99 Alignments for each domain: == domain 1 score: 403.3 bits; conditional E-value: 3.2e-125 TIGR00658 1 rhllslldlseeelkellelakklkkekkkgkeekklkgktlaliFekrstRtRvsfevaayelGaqvly 70 r+ll+++d+s++++ ll+la++lk++k++g+e +l+gk++aliFek+stRtR++feva+ ++G++v+y lcl|FitnessBrowser__BFirm:BPHYT_RS27685 8 RSLLNMQDFSPRDIGFLLDLAAELKRAKYAGNEVPRLNGKNVALIFEKTSTRTRCAFEVAVHDQGGHVTY 77 78******************************************************************** PP TIGR00658 71 lnkeelqlgrkesikDtarvlsryvdaivvRvykhedveelakyasvPvingLtdlehPcqilaDlltik 140 +++ ++qlgrkes+kDtarvl+r++d+i +R+++++ ve+la y+ vPv+ngLtd++hP+q+laDllt++ lcl|FitnessBrowser__BFirm:BPHYT_RS27685 78 IDSASSQLGRKESLKDTARVLGRLYDGIEYRGFHQSVVEDLAAYSHVPVWNGLTDEFHPTQVLADLLTMR 147 ********************************************************************** PP TIGR00658 141 eklg.klkevklvyvGDa.nnvanslllaaaklGldvvvatPeglepeaeivkkakkiakenggklelte 208 e + l+e+++ y+GDa n++nsll++++++G+dv++a+P++l+p+ e+v++ +++a+++g++++++e lcl|FitnessBrowser__BFirm:BPHYT_RS27685 148 EFGEkPLHELSFCYLGDArFNMGNSLLIGGVQMGMDVRIAAPRELWPHDELVQQMRHLAERTGASVTIVE 217 *99989************99************************************************** PP TIGR00658 209 dpkkavkdadviytDvwvsmGe.eekkeerlkllkpyqvneellela.kpevkflhCLPavr........ 268 dp+ +v +ad++ytDvwvsmGe e++ r++ll pyqvn l++ + k+ + f+hCLPa + lcl|FitnessBrowser__BFirm:BPHYT_RS27685 218 DPVAGVGGADFVYTDVWVSMGEpMEAWGPRIDLLLPYQVNAALMKATgKSRTRFMHCLPAYHnletdigr 287 **********************9999*********************9********************** PP TIGR00658 269 .........GeevtdevlegeasivfdeaenRlhaqkavlkall 303 ev+dev+e++asivf +aenR+h++kavl+a+l lcl|FitnessBrowser__BFirm:BPHYT_RS27685 288 qlherfglsELEVSDEVFESNASIVFSQAENRMHTIKAVLVATL 331 ******99889******************************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (332 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 10.28 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory