Align L-leucine transaminase; L-isoleucine transaminase (EC 2.6.1.42) (characterized)
to candidate CCNA_03215 CCNA_03215 ARO8 family aminotransferase/HTH DNA-binding protein
Query= reanno::acidovorax_3H11:Ac3H11_1358 (401 letters) >FitnessBrowser__Caulo:CCNA_03215 Length = 471 Score = 111 bits (278), Expect = 4e-29 Identities = 113/371 (30%), Positives = 165/371 (44%), Gaps = 33/371 (8%) Query: 34 EKPGIISLAGGLPSPKTFPVSA--FAAASAAVLANDGPAALQ-YAASEGYAPLRQAIADF 90 ++ G+I L+ LP P A A+ A+LA PA L Y G R A A + Sbjct: 118 DEAGLIDLSMNLPPPPQGLNLAGLLQDATRAILARTEPATLMAYHPGAGSLAQRSAGAAW 177 Query: 91 LP---WDVDADQILITTGSQQALDLIAKVLIDENSRVLVETPTYLGALQAFTPMEPSVVA 147 L VD ++++T G+Q AL + L ++VE TY G L ++VA Sbjct: 178 LAPTLGPVDPGRVVVTGGAQTALSALLDYLAAPGDTIIVEAFTYPGLLATARRRGLTLVA 237 Query: 148 VASDDEGVLIDDLKAKVGTGADKARFLYVLPNFQNPTGRTMTEARRAALVKAAAELNLPL 207 DDEG+ + L V R + P FQNPT TM+ ARRAA+++ A + + Sbjct: 238 CPLDDEGLQPEALAQLVAQHGP--RLICCTPTFQNPTAATMSPARRAAVIEIARAAGVTI 295 Query: 208 VEDNPYGDLWFDNPPPAPLTARNPEGCIYMGSFSKVLAPGLRLGFVVAPKAVYPKLLQAK 267 +ED+ YG L +P PA L A PEG ++ + +K L+PGLRL +VVAP QA Sbjct: 296 LEDDAYG-LLPASPAPA-LAALWPEGVYHVATTAKALSPGLRLAYVVAPPGCAEGFAQAL 353 Query: 268 QA-ADLHTPGYNQRLVAEVMKGNFLDRHVPTIRALYKQQC---EAMLAALTQEMAGLGVE 323 A A + P L+A ++ D + A + + A+ A L G Sbjct: 354 HAIAQMPAP-----LMAGIVTQWIRDGVAAKVLAGVRSEAVARRALAATLLPRAVG---- 404 Query: 324 WNRPDGGMFLWVRLPEGMSAIELLPQAVERNVAFVPGAAFYADNADPRTLRLSF-VTSTV 382 + +W ++ E P A ER +A V AF A LR+S T+ Sbjct: 405 ---DAESLHVW------LAGAEAPPAARERGLALVGANAFRAPGVTGEGLRISLGATAKR 455 Query: 383 EQIATGIAALA 393 + G+ ALA Sbjct: 456 AALTQGLKALA 466 Lambda K H 0.318 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 484 Number of extensions: 28 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 471 Length adjustment: 32 Effective length of query: 369 Effective length of database: 439 Effective search space: 161991 Effective search space used: 161991 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory