Align histidinol-phosphate aminotransferase (EC 2.6.1.9) (characterized)
to candidate Dsui_1414 Dsui_1414 histidinol-phosphate aminotransferase
Query= reanno::psRCH2:GFF3234 (348 letters) >FitnessBrowser__PS:Dsui_1414 Length = 395 Score = 490 bits (1262), Expect = e-143 Identities = 253/353 (71%), Positives = 287/353 (81%), Gaps = 6/353 (1%) Query: 1 MSKFWSPFVKDLVPYVPGEQPKLSKLVKLNTNENPYGPSPRAIAAMQAELND---SLRLY 57 MSKFWSP V L PYVPGEQPKL LVKLNTNENPY PSP+ +AAMQAE+ SLRLY Sbjct: 38 MSKFWSPLVNRLTPYVPGEQPKLPNLVKLNTNENPYPPSPKTVAAMQAEIGHDGASLRLY 97 Query: 58 PDPNGERLKQAVADYYG---VQPAQVFVGNGSDEVLAHAFHGLFQHAGPLLFPDISYSFY 114 PDP+ +RLK+AVA +YG + QVFVGNGSDEVLAH F L QH PLL+PDISYSFY Sbjct: 98 PDPSADRLKEAVAAFYGEFGIGARQVFVGNGSDEVLAHVFMALLQHDAPLLYPDISYSFY 157 Query: 115 PVYCGLYGIAYETVALDEQFQIDVADYNRPNGGIIFPNPNAPTGCLLALEAIERLLQANT 174 PVY GLYGI+ ETVALD + ID++ Y R NGGIIFPNPNAPTG LL L IE LL ANT Sbjct: 158 PVYAGLYGISAETVALDGDYGIDLSAYRRANGGIIFPNPNAPTGRLLPLGEIEALLTANT 217 Query: 175 ETVVLVDEAYVDFGGESAIALVDRYPNLLVTQTLSKSRSLAGLRVGLAVGHPDLIEALER 234 E+VV+VDEAYVDFGG++AIALV+R+PNLLV TLSKSRSLAGLRVG AVGHPDLIEALER Sbjct: 218 ESVVVVDEAYVDFGGDTAIALVNRFPNLLVVHTLSKSRSLAGLRVGYAVGHPDLIEALER 277 Query: 235 IKNSFNSYPLDRIAIAGAAAAFEDRAYFQQTCQQVIDSREAVVAAMQGLGFEVLPSAANF 294 +KNSFNSYPLDRIAIAGA AA EDRA+F +T VI SRE +V+ + LGF+VLPSAANF Sbjct: 278 VKNSFNSYPLDRIAIAGAVAALEDRAWFDRTRNAVIASREQLVSDLTLLGFQVLPSAANF 337 Query: 295 IFARHPQRDAATIAASLREQGVIVRHFKQRRIEQFLRITIGTPEQNQALLEAL 347 +FARHP RD A +A +LR++ +IVRHFK RI+QFLRITIGT EQ AL+ AL Sbjct: 338 VFARHPGRDGAELAQALRQRSIIVRHFKAPRIDQFLRITIGTDEQCGALVAAL 390 Lambda K H 0.320 0.137 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 544 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 348 Length of database: 395 Length adjustment: 30 Effective length of query: 318 Effective length of database: 365 Effective search space: 116070 Effective search space used: 116070 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate Dsui_1414 Dsui_1414 (histidinol-phosphate aminotransferase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.31535.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.8e-92 294.0 0.0 7.7e-92 293.8 0.0 1.0 1 lcl|FitnessBrowser__PS:Dsui_1414 Dsui_1414 histidinol-phosphate a Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PS:Dsui_1414 Dsui_1414 histidinol-phosphate aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 293.8 0.0 7.7e-92 7.7e-92 4 349 .] 46 393 .. 43 393 .. 0.93 Alignments for each domain: == domain 1 score: 293.8 bits; conditional E-value: 7.7e-92 TIGR01141 4 ikklepYqpgarelgekevvkLnsnEnPfgpsekvkealkeelk....klhrYpdpqalelkealakylg...veee 73 ++ l+pY+pg++ + + vkLn+nEnP++ps+k ++a+++e+ +l++Ypdp+a +lkea+a+++g +++ lcl|FitnessBrowser__PS:Dsui_1414 46 VNRLTPYVPGEQPKLP-NLVKLNTNENPYPPSPKTVAAMQAEIGhdgaSLRLYPDPSADRLKEAVAAFYGefgIGAR 121 789******9666555.6*************************888999*******************99999**** PP TIGR01141 74 nillgnGsdelielliraflepgdavlvleptysmYevsakiagaevkevplkedgqedleavleaakekvklvfla 150 ++++gnGsde++ +++a+l+ + l+++ +ys Y+v+a ++g++ +v+l+ d dl a + + + lcl|FitnessBrowser__PS:Dsui_1414 122 QVFVGNGSDEVLAHVFMALLQHDAPLLYPDISYSFYPVYAGLYGISAETVALDGDYGIDLSAYR---RANGG-IIFP 194 *******************************************************656666665...33334.5569 PP TIGR01141 151 sPnnPtGnllkreeiekvleevedalVVvDeAYieFseeasvlellaeypnlvvlrTlSKafgLAglRvGyaianae 227 +Pn+PtG ll eie++l + ++ +VVvDeAY++F ++ +++ l++++pnl+v+ TlSK+ +LAglRvGya+++++ lcl|FitnessBrowser__PS:Dsui_1414 195 NPNAPTGRLLPLGEIEALLTANTESVVVVDEAYVDFGGD-TAIALVNRFPNLLVVHTLSKSRSLAGLRVGYAVGHPD 270 *******************99889**************8.************************************* PP TIGR01141 228 iiealekvrapyn...vsslaleaavaalrdsdkiektveevkkererlleelkkleglevyeSkaNFvlikvke.d 300 +ieale+v++++n ++++a + avaal+d++ + +t ++v+++re+l + l+ l g++v +S aNFv+++ + d lcl|FitnessBrowser__PS:Dsui_1414 271 LIEALERVKNSFNsypLDRIAIAGAVAALEDRAWFDRTRNAVIASREQLVSDLTLL-GFQVLPSAANFVFARHPGrD 346 *********87543339*************************************99.8***************999* PP TIGR01141 301 aeelleallekgiivRdlksaeglleeclRitvGtreenerllealkei 349 +el++al ++ iivR++k+ + ++++lRit+Gt+e++ +l++alkei lcl|FitnessBrowser__PS:Dsui_1414 347 GAELAQALRQRSIIVRHFKA--PRIDQFLRITIGTDEQCGALVAALKEI 393 ******************94..468*********************996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (395 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.30 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory