Align 3-dehydroquinate synthase, chloroplastic; EC 4.2.3.4 (characterized)
to candidate GFF1393 PGA1_c14100 3-dehydroquinate synthase AroB
Query= SwissProt::Q8RU74 (442 letters) >FitnessBrowser__Phaeo:GFF1393 Length = 375 Score = 279 bits (713), Expect = 1e-79 Identities = 164/363 (45%), Positives = 216/363 (59%), Gaps = 9/363 (2%) Query: 81 VEVDLGTRSYPIYIGAGLL-DQPDLLQRHIHGKRVLVVTNTTVAPLYLDKTISALTDGNP 139 V V LG R+Y + IG LL D L + +V V+T+ TVA +L+ + L Sbjct: 10 VHVALGERAYDVVIGPDLLADAGARLAPMLRRPKVAVLTDETVAAHHLEGLRAGLASAG- 68 Query: 140 NVTVESVILPDGEQFKNMETLMKVFDKAIESRLDRRCTFVALGGGVIGDMCGYAAASYLR 199 + ++++ LP GE K + + +E +++R +A GGGVIGD+ G+AAA R Sbjct: 69 -IEMDALALPPGESTKAWPQFSRAVEWLLEQKVERGDIVIAFGGGVIGDLAGFAAAVLRR 127 Query: 200 GVNFIQIPTTVMAQVDSSVGGKTGINHPLGKNMIGAFYQPQCVLIDTDTLNTLPDRELAS 259 GV F+QIPT+++AQVDSSVGGKTGIN P GKN+IGAF+QP VL DT L TL R+ + Sbjct: 128 GVRFVQIPTSLLAQVDSSVGGKTGINAPQGKNLIGAFHQPSLVLADTALLGTLTPRDFLA 187 Query: 260 GLAEVIKYGLIRDAEFFEWQEQNMPLLLARDPTAFTYAIKRSCENKADVVSQDEKESGVR 319 G EV+KYGL+ DAEFFEW E P L A D A A+ RS + KAD+V +DE E G R Sbjct: 188 GYGEVVKYGLLGDAEFFEWLEAQGPALAAGDMAARVEAVTRSVQMKADIVVRDETEQGDR 247 Query: 320 ATLNLGHTFGHAVETGVGYG-QWLHGEAVAAGTVMAVDMSRRLGWIDDSLVQRVQKILQQ 378 A LNLGHTF HA+E GYG + LHGE VA G +A ++S RLG RV+ L+ Sbjct: 248 ALLNLGHTFCHALEAATGYGDRLLHGEGVAIGCALAFELSARLGLCSQEDPSRVRAHLKA 307 Query: 379 AKLPTS----PPETMTVEMFKSIMAVDKKVADGKLRLILLKGSLGNCVFTGDYDQKALDE 434 + T P E E ++M DKKV DG+LR IL +G +G TGD Q A+ + Sbjct: 308 MGMKTDLADIPGELPDAEALLALMGQDKKVVDGQLRFILARG-IGQAFVTGDVPQAAVLD 366 Query: 435 TLR 437 LR Sbjct: 367 VLR 369 Lambda K H 0.318 0.133 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 357 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 442 Length of database: 375 Length adjustment: 31 Effective length of query: 411 Effective length of database: 344 Effective search space: 141384 Effective search space used: 141384 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate GFF1393 PGA1_c14100 (3-dehydroquinate synthase AroB)
to HMM TIGR01357 (aroB: 3-dehydroquinate synthase (EC 4.2.3.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01357.hmm # target sequence database: /tmp/gapView.24416.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01357 [M=344] Accession: TIGR01357 Description: aroB: 3-dehydroquinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.9e-111 356.5 0.0 8.9e-111 356.3 0.0 1.0 1 lcl|FitnessBrowser__Phaeo:GFF1393 PGA1_c14100 3-dehydroquinate syn Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF1393 PGA1_c14100 3-dehydroquinate synthase AroB # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 356.3 0.0 8.9e-111 8.9e-111 1 341 [. 19 366 .. 19 369 .. 0.97 Alignments for each domain: == domain 1 score: 356.3 bits; conditional E-value: 8.9e-111 TIGR01357 1 ykvkvgegllkklveelae..kasklvvitdeeveklvaekleealkslgvevlvlvvpdgeesKsletvaklldq 74 y+v++g +ll+ + + la ++ k+ v+tde+v++++ e l++ l+s+g+e++ l +p+ge++K + ++++ +++ lcl|FitnessBrowser__Phaeo:GFF1393 19 YDVVIGPDLLADAGARLAPmlRRPKVAVLTDETVAAHHLEGLRAGLASAGIEMDALALPPGESTKAWPQFSRAVEW 94 7899*******99999999766699*************************************************** PP TIGR01357 75 lleeklerksvlvaiGGGvvgDlaGFvAatylRGirlvqvPTtllamvDssvGGKtginlplgkNliGafyqPkaV 150 lle+k+er ++++a+GGGv+gDlaGF+Aa+ RG+r+vq+PT+lla+vDssvGGKtgin p+gkNliGaf+qP++V lcl|FitnessBrowser__Phaeo:GFF1393 95 LLEQKVERGDIVIAFGGGVIGDLAGFAAAVLRRGVRFVQIPTSLLAQVDSSVGGKTGINAPQGKNLIGAFHQPSLV 170 **************************************************************************** PP TIGR01357 151 lidlkvletlperelreGmaEviKhgliadaelfeelekneklllklaelealeelikrsievKaevVeeDekesg 226 l d+++l tl+ r + +G++Ev+K+gl+ dae+fe+le + +l +++a e+++rs+++Ka++V +De+e+g lcl|FitnessBrowser__Phaeo:GFF1393 171 LADTALLGTLTPRDFLAGYGEVVKYGLLGDAEFFEWLEAQGPALAA-GDMAARVEAVTRSVQMKADIVVRDETEQG 245 ***************************************9998776.5669999********************** PP TIGR01357 227 lRalLNfGHtlgHaiEallkyk..lsHGeaVaiGmvveaklseklgllkaellerlvallkklglptklkk....k 296 RalLN+GHt+ Ha+Ea+++y+ l HGe VaiG +++++ls +lgl+++e+ +r++a lk++g++t+l + lcl|FitnessBrowser__Phaeo:GFF1393 246 DRALLNLGHTFCHALEAATGYGdrLLHGEGVAIGCALAFELSARLGLCSQEDPSRVRAHLKAMGMKTDLADipgeL 321 *********************999**********************************************999987 PP TIGR01357 297 lsveellkallkDKKnegskiklvlleeiGkaalasevteeelle 341 ++e+ll+ + +DKK +++++++l++ iG+a+++ +v++ ++l+ lcl|FitnessBrowser__Phaeo:GFF1393 322 PDAEALLALMGQDKKVVDGQLRFILARGIGQAFVTGDVPQAAVLD 366 89********************************99999888776 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (344 nodes) Target sequences: 1 (375 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.58 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory