GapMind for Amino acid biosynthesis

 

Alignments for a candidate for hisE in Phaeobacter inhibens BS107

Align Phosphoribosyl-AMP cyclohydrolase; PRA-CH; EC 3.5.4.19 (characterized)
to candidate GFF1423 PGA1_c14400 phosphoribosyl-AMP cyclohydrolase Hisl

Query= SwissProt::O26347
         (138 letters)



>FitnessBrowser__Phaeo:GFF1423
          Length = 125

 Score =  118 bits (295), Expect = 4e-32
 Identities = 58/116 (50%), Positives = 82/116 (70%), Gaps = 3/116 (2%)

Query: 12  LNFRHNINGEDLIIAVAQDHETGEVLMVAYMNREALRRTLETGTAHYWSTSRGKLWLKGE 71
           L+ ++N  G  LI  +AQ+ ++GEVLM+A+MN +A+ +TLE+G   YWS SR   W+KGE
Sbjct: 12  LSLKYNEAG--LIPCIAQEEDSGEVLMMAWMNADAVMKTLESGRVTYWSRSRQAFWIKGE 69

Query: 72  SSGHVQRVKDVLVDCDGDAVVLKVEQEGGACHTGYRSCFYRSI-DGDELKVREDAV 126
           SSGHVQ + D+ VDCD D ++  V Q G ACHT  RSCFY +I DG+E+++ +  V
Sbjct: 70  SSGHVQALVDLRVDCDRDCLLAVVRQSGPACHTNRRSCFYTAIRDGEEVELMQPMV 125


Lambda     K      H
   0.318    0.137    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 81
Number of extensions: 1
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 138
Length of database: 125
Length adjustment: 14
Effective length of query: 124
Effective length of database: 111
Effective search space:    13764
Effective search space used:    13764
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 41 (20.4 bits)

Align candidate GFF1423 PGA1_c14400 (phosphoribosyl-AMP cyclohydrolase Hisl)
to HMM PF01502 (PRA-CH)

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/PF01502.22.hmm
# target sequence database:        /tmp/gapView.29816.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       PRA-CH  [M=74]
Accession:   PF01502.22
Description: Phosphoribosyl-AMP cyclohydrolase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                          -----------
    3.2e-39  119.0   0.5    4.2e-39  118.6   0.5    1.2  1  lcl|FitnessBrowser__Phaeo:GFF1423  PGA1_c14400 phosphoribosyl-AMP c


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Phaeo:GFF1423  PGA1_c14400 phosphoribosyl-AMP cyclohydrolase Hisl
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  118.6   0.5   4.2e-39   4.2e-39       1      74 []      36     109 ..      36     109 .. 0.99

  Alignments for each domain:
  == domain 1  score: 118.6 bits;  conditional E-value: 4.2e-39
                             PRA-CH   1 mlaymneealektletgkavyySrsrqklwkkGetsgnvqkvkeirldcDeDalllkveqkgaaCHtgersCFy 74 
                                        m+a+mn++a+ ktle+g+++y+Srsrq +w kGe+sg+vq ++++r+dcD+D+ll+ v+q+g+aCHt++rsCFy
  lcl|FitnessBrowser__Phaeo:GFF1423  36 MMAWMNADAVMKTLESGRVTYWSRSRQAFWIKGESSGHVQALVDLRVDCDRDCLLAVVRQSGPACHTNRRSCFY 109
                                        9************************************************************************7 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (74 nodes)
Target sequences:                          1  (125 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
# Mc/sec: 3.51
//
[ok]

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory