Align glutamate 5-kinase (EC 2.7.2.11) (characterized)
to candidate GFF1532 PGA1_c15510 glutamate 5-kinase ProB
Query= reanno::Korea:Ga0059261_3512 (367 letters) >FitnessBrowser__Phaeo:GFF1532 Length = 368 Score = 302 bits (774), Expect = 8e-87 Identities = 180/363 (49%), Positives = 238/363 (65%), Gaps = 10/363 (2%) Query: 11 RLVVKIGSALLVD-PEGAIRRDWLEGIAADIAARVRAGQQIAVVSSGAIALGARRLKLAK 69 R+VVKIGSALLVD GA+R DWL +AAD+A G+ + +VSSG+IALG R L LA Sbjct: 9 RIVVKIGSALLVDRTSGALRADWLRALAADVAWLKSMGKDVILVSSGSIALGRRVLGLA- 67 Query: 70 GGRASLEDAQAAAATGQIALSQVWAEVLAANGLTAAQMLVTLDDLEDRRRYLNAAATLGR 129 LE +QAAAA GQI L+ + E LA + +T AQ+LVTL+D DRRRYLN+ ATL Sbjct: 68 AQELPLEQSQAAAAVGQIRLAGAYEEALAPHEITTAQVLVTLEDSADRRRYLNSRATLET 127 Query: 130 LLSLGVVPVINENDSVATAEIRFGDNDRLAARVAQAADASGVVLLSDIDGLYDRNPAL-P 188 L+ LGVVP++NEND++AT EIR+GDNDRLAA+VA A ++LLSD+DG Y NP L P Sbjct: 128 LIGLGVVPIVNENDTIATDEIRYGDNDRLAAQVAVTVGADALILLSDVDGFYTANPVLDP 187 Query: 189 GAVHIPVVERIDGRVEGMADRGSASGMGSGGMVSKIEAARIAASAGVSLAIANGRVDRPL 248 A +++RI +E MA G SG+ GGM++K+ AA++A +AG ++AI G + PL Sbjct: 188 TARRYDIIDRITPEIEAMAGDG-VSGLSKGGMITKLLAAKMATAAGCAMAITEGSPNNPL 246 Query: 249 SA---DARHTVFLPEKRTR-ARKAWLAGRLTAKGSIIVDAGAAQALTEGRSLLAIGATAI 304 A T F + + ARK W+A T +G + VD GAA+AL G+SLL G I Sbjct: 247 KLLENGAPSTWFTAQDDPQVARKRWIAAMKT-RGVVAVDEGAARALGSGKSLLPAGIRHI 305 Query: 305 RGMFFRGDLVTIEGPNG-PIARGLSEYDAPDAQAILGTRSDDQGEILGYAPRSTLVHRNH 363 G F RGD + I GP+G + +GLS Y A +A AI G +S + ILGYA R+ ++HR+ Sbjct: 306 EGDFGRGDPLAILGPDGRKLGQGLSRYTAEEASAIKGCQSTEIEAILGYAGRAAVIHRDD 365 Query: 364 MAL 366 MAL Sbjct: 366 MAL 368 Lambda K H 0.319 0.134 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 372 Number of extensions: 27 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 368 Length adjustment: 30 Effective length of query: 337 Effective length of database: 338 Effective search space: 113906 Effective search space used: 113906 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate GFF1532 PGA1_c15510 (glutamate 5-kinase ProB)
to HMM TIGR01027 (proB: glutamate 5-kinase (EC 2.7.2.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01027.hmm # target sequence database: /tmp/gapView.19079.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01027 [M=363] Accession: TIGR01027 Description: proB: glutamate 5-kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-117 379.1 0.1 1.3e-117 378.9 0.1 1.0 1 lcl|FitnessBrowser__Phaeo:GFF1532 PGA1_c15510 glutamate 5-kinase P Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF1532 PGA1_c15510 glutamate 5-kinase ProB # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 378.9 0.1 1.3e-117 1.3e-117 1 362 [. 8 367 .. 8 368 .] 0.98 Alignments for each domain: == domain 1 score: 378.9 bits; conditional E-value: 1.3e-117 TIGR01027 1 kriVvKlGsssLteesgk.lkrsklaelveqvaklkkaGhevvivsSGavaaGleaLglperpkklaekQalaaVG 75 +riVvK+Gs++L++ ++ l++ l++l+++va lk++G++v++vsSG++a G + Lgl ++ l++ Qa+aaVG lcl|FitnessBrowser__Phaeo:GFF1532 8 QRIVVKIGSALLVDRTSGaLRADWLRALAADVAWLKSMGKDVILVSSGSIALGRRVLGLAAQELPLEQSQAAAAVG 83 69***********987766********************************************************* PP TIGR01027 76 QgrLmklyeklfsqyglkvaQiLLtradlskrerylNarntleellelgvvpivNENDtvaveeikfGDNDtLsal 151 Q rL +ye++++ +++++aQ+L t +d ++r+rylN r+tle+l+ lgvvpivNENDt+a++ei+ GDND+L+a+ lcl|FitnessBrowser__Phaeo:GFF1532 84 QIRLAGAYEEALAPHEITTAQVLVTLEDSADRRRYLNSRATLETLIGLGVVPIVNENDTIATDEIRYGDNDRLAAQ 159 **************************************************************************** PP TIGR01027 152 vaalveAdlLvlltdvdgLydadprtnpdAklieeveeieeelkavagssgssvGTGGmrtKleaaelAsragvev 227 va v+Ad+L+ll+dvdg y+a+p +p+A++ + +++i+ e++a+ag++ s + GGm tKl aa++A++ag + lcl|FitnessBrowser__Phaeo:GFF1532 160 VAVTVGADALILLSDVDGFYTANPVLDPTARRYDIIDRITPEIEAMAGDGVSGLSKGGMITKLLAAKMATAAGCAM 235 **************************************************************************** PP TIGR01027 228 iiasgekpekiadlledaavgtlfeakkkklknrkqwilaaseakGkiivdegaeeallekgksLlpagvvevegn 303 i++g+ p++ ++lle+ a t f+a++ +rk+wi+a+++ +G + vdega++al + gksLlpag+ ++eg+ lcl|FitnessBrowser__Phaeo:GFF1532 236 AITEGS-PNNPLKLLENGAPSTWFTAQDDPQVARKRWIAAMKT-RGVVAVDEGAARALGS-GKSLLPAGIRHIEGD 308 *****9.79999999999********************98765.5**************9.*************** PP TIGR01027 304 FsrgevveilaeegqeigkglvnysseelekikglkseeiedvLgyekkeevvhrdnlv 362 F rg+ + il ++g+++g+gl++y++ee + ikg +s+eie++Lgy ++ v+hrd+++ lcl|FitnessBrowser__Phaeo:GFF1532 309 FGRGDPLAILGPDGRKLGQGLSRYTAEEASAIKGCQSTEIEAILGYAGRAAVIHRDDMA 367 *********************************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (363 nodes) Target sequences: 1 (368 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 7.25 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory