Align histidinol-phosphate aminotransferase; tyrosine/phenylalanine aminotransferase (promiscuous) (EC 2.6.1.1; EC 2.6.1.9) (characterized)
to candidate GFF1942 Psest_1985 histidinol-phosphate aminotransferase
Query= metacyc::BSU22620-MONOMER (360 letters) >FitnessBrowser__psRCH2:GFF1942 Length = 369 Score = 288 bits (737), Expect = 2e-82 Identities = 157/356 (44%), Positives = 220/356 (61%), Gaps = 3/356 (0%) Query: 7 LKQLKPYQPGKPIEAVKSEYGLDK--VVKLASNENPYGCSEAAKEALHHEIQQLALYPDG 64 +++L PY PGKP++ + E LD +VKLASNENP G S +A+ E+ +L YPDG Sbjct: 13 VQKLSPYVPGKPVDELARELNLDPAGIVKLASNENPLGPSPKVLDAIRAELSELTRYPDG 72 Query: 65 YSAALRTRLSKHLNVSETSLIFGNGSDEIIQIICRAFLNDKTNTVTAAPTFPQYKHNAVI 124 AL+ RL++ +V + GNGS++I+++I RA+L N V + F Y Sbjct: 73 NGFALKQRLAERYSVGINQVTLGNGSNDILELIARAYLAPGLNAVFSEHAFAVYPIATQA 132 Query: 125 EGAEVREIALRPDGSHDLDAMLEAIDEQTQVVWICSPNNPTGTYTSEGELLAFLERVPSR 184 GAE R + + G HDLDAM AIDE T+VV++ +PNNPTGT+ L FL RVP Sbjct: 133 VGAEGRAVPAKNWG-HDLDAMAAAIDENTRVVFVANPNNPTGTWFDAAALGGFLARVPEH 191 Query: 185 VLVVLDEAYYEYVTAEDYPETVPLLSKYSNLMILRTFSKAYGLAALRVGYGIADENLIRQ 244 VLVVLDEAY EY ++ P+ + L+ Y NL++ RTFSKAYGLAALRVGY I+ + Sbjct: 192 VLVVLDEAYIEYAEGQELPDGLAFLADYPNLLVSRTFSKAYGLAALRVGYAISSPVIADV 251 Query: 245 IEPAREPFNTSRLGQAAAIAALDDQAFIASCVEQNNAGLQQYYDFAKTHGLKCYPSQTNF 304 + R+PFN + L AAA AALDD ++ + + N+AG+ Q + GL+ PS+ NF Sbjct: 252 LNRVRQPFNVNSLALAAACAALDDVDYLLASRKANDAGMLQLETGFRQLGLEWIPSRGNF 311 Query: 305 VLIDFKRPADELFQALLEKGYIVRSGNALGFPTSLRITIGTKEQNEEILAILAEIL 360 + +DF R A + QALL +G IVR G PT LR++IGT+++N L +L ++L Sbjct: 312 IAVDFARDATPINQALLREGVIVRPVAGYGMPTFLRVSIGTEQENARFLDVLRQVL 367 Lambda K H 0.317 0.134 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 358 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 369 Length adjustment: 29 Effective length of query: 331 Effective length of database: 340 Effective search space: 112540 Effective search space used: 112540 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate GFF1942 Psest_1985 (histidinol-phosphate aminotransferase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.30165.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.2e-118 379.6 0.0 7e-118 379.4 0.0 1.0 1 lcl|FitnessBrowser__psRCH2:GFF1942 Psest_1985 histidinol-phosphate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__psRCH2:GFF1942 Psest_1985 histidinol-phosphate aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 379.4 0.0 7e-118 7e-118 2 349 .] 11 366 .. 10 366 .. 0.98 Alignments for each domain: == domain 1 score: 379.4 bits; conditional E-value: 7e-118 TIGR01141 2 ekikklepYqpg......arelgek..evvkLnsnEnPfgpsekvkealkeelkklhrYpdpqalelkealakyl 68 + ++kl+pY+pg arel + ++vkL+snEnP+gps+kv++a+++el++l+rYpd ++++lk++la+++ lcl|FitnessBrowser__psRCH2:GFF1942 11 PGVQKLSPYVPGkpvdelARELNLDpaGIVKLASNENPLGPSPKVLDAIRAELSELTRYPDGNGFALKQRLAERY 85 679***************999999999************************************************ PP TIGR01141 69 gveeenillgnGsdelielliraflepgdavlvleptysmYevsakiagaevkevplkedgqedleavleaakek 143 +v+ ++++lgnGs++++el++ra+l pg +++++e+++++Y++ +++ gae + vp+k++g +dl+a+++a++e+ lcl|FitnessBrowser__psRCH2:GFF1942 86 SVGINQVTLGNGSNDILELIARAYLAPGLNAVFSEHAFAVYPIATQAVGAEGRAVPAKNWG-HDLDAMAAAIDEN 159 *********************************************************9995.9************ PP TIGR01141 144 vklvflasPnnPtGnllkreeiekvleev.edalVVvDeAYieFsee...asvlellaeypnlvvlrTlSKafgL 214 +++vf+a+PnnPtG++++++ + +l++v e++lVV+DeAYie++e ++ l +la+ypnl+v+rT+SKa+gL lcl|FitnessBrowser__psRCH2:GFF1942 160 TRVVFVANPNNPTGTWFDAAALGGFLARVpEHVLVVLDEAYIEYAEGqelPDGLAFLADYPNLLVSRTFSKAYGL 234 *****************************99**************99899999********************** PP TIGR01141 215 AglRvGyaianaeiiealekvrapynvsslaleaavaalrdsdkiektveevkkererlleelkkleglevyeSk 289 A+lRvGyai+++ i+++l++vr+p+nv+slal+aa+aal+d d++ ++ +++ +++ +l++++++l gle+++S lcl|FitnessBrowser__psRCH2:GFF1942 235 AALRVGYAISSPVIADVLNRVRQPFNVNSLALAAACAALDDVDYLLASRKANDAGMLQLETGFRQL-GLEWIPSR 308 ******************************************************************.8******* PP TIGR01141 290 aNFvlikvkedaeelleallekgiivRdlksaeglleeclRitvGtreenerllealkei 349 +NF+ +++ +da+ + +all++g+ivR ++ + g+ +++lR+++Gt++en r+l++l+++ lcl|FitnessBrowser__psRCH2:GFF1942 309 GNFIAVDFARDATPINQALLREGVIVRPVAGY-GM-PTFLRVSIGTEQENARFLDVLRQV 366 ********************************.96.*********************985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (369 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 12.05 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory