Align O-succinylhomoserine sulfhydrylase; OSH sulfhydrylase; OSHS sulfhydrylase; EC 2.5.1.- (characterized)
to candidate GFF2323 PGA1_c23540 O-succinylhomoserine sulfhydrylase MetZ
Query= SwissProt::P55218 (403 letters) >FitnessBrowser__Phaeo:GFF2323 Length = 396 Score = 354 bits (908), Expect = e-102 Identities = 186/384 (48%), Positives = 256/384 (66%), Gaps = 3/384 (0%) Query: 21 TLAVRAGQRRTPEGEHGEALFTTSSYVFRTAADAAARFAGEVPGN-VYSRYTNPTVRTFE 79 T V G RR+ E EA++ T +V+ TA A ARF P +Y+RY NPTV FE Sbjct: 9 TKLVHGGTRRSQYNEVSEAIYLTQGFVYDTAEQAEARFIETGPDEFIYARYGNPTVAMFE 68 Query: 80 ERIAALEGAEQAVATASGMSAILALVMSLCSSGDHVLVSRSVFGSTISLFDKYFKRFGIQ 139 ERIAALEGAE A ATASGM+A+ + S+ +GDHV+ ++++FGS + + + R+G++ Sbjct: 69 ERIAALEGAEDAFATASGMAAVNGALTSILKAGDHVVSAKALFGSCLYILENILTRYGVE 128 Query: 140 VDYPPLSDLAAWEAACKPNTKLFFVESPSNPLAELVDIAALAEIAHAKGALLAVDNCFCT 199 V + +DL AW AA +P+TK F ES SNP E++DIAA+AE+AHA GA + VDN F T Sbjct: 129 VTFVDGTDLDAWRAALRPDTKAVFFESMSNPTLEVIDIAAVAELAHAVGATVVVDNVFST 188 Query: 200 PALQQPLKLGADVVIHSATKYIDGQGRGMGGVVAGRGEQMKEVV-GFLRTAGPTLSPFNA 258 P ++ GADVVI+SATK+IDGQGR +GGV+ G + ++ V +++ G +LSPFNA Sbjct: 189 PVFSNAIEQGADVVIYSATKHIDGQGRVLGGVILGTRDFIRGTVEPYMKHTGGSLSPFNA 248 Query: 259 WLFLKGLETLRIRMQAHSASALALAEWLERQPGIERVYYAGLPSHPQHELARRQQSG-FG 317 W LKGLET+ +R+ A + +AL LA+ L P + R+ Y GL H QH L +RQ G G Sbjct: 249 WTLLKGLETISLRVNAQAETALELAQALSGHPALSRLMYPGLEDHAQHALVQRQLGGKGG 308 Query: 318 AVVSFDVKGGRDAAWRFIDATRMVSITTNLGDTKTTIAHPATTSHGRLSPEDRARAGIGD 377 V+S D+KGG+DAA+RF++A + I+ NLGD K+ HPATT+H RLS E ++ GI Sbjct: 309 TVLSLDLKGGKDAAFRFLNALTIPVISNNLGDAKSIATHPATTTHQRLSEELKSELGITP 368 Query: 378 SLIRVAVGLEDLDDLKADMARGLA 401 L+R +VGLED DL AD+ + LA Sbjct: 369 GLVRFSVGLEDAGDLIADLTQALA 392 Lambda K H 0.319 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 364 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 403 Length of database: 396 Length adjustment: 31 Effective length of query: 372 Effective length of database: 365 Effective search space: 135780 Effective search space used: 135780 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory