Align Histidinol dehydrogenase; HDH; EC 1.1.1.23 (uncharacterized)
to candidate GFF2510 PGA1_c25490 histidinol dehydrogenase HisD
Query= curated2:Q5SKC1 (412 letters) >FitnessBrowser__Phaeo:GFF2510 Length = 421 Score = 255 bits (651), Expect = 2e-72 Identities = 155/406 (38%), Positives = 233/406 (57%), Gaps = 17/406 (4%) Query: 20 DPTVEEIVRGILEAVREEGDEALDRFSRDLDGYPVEEV-----PKRAWREAYEDLDEDLR 74 D V +IV +L+ + EG+E + R+++ LDG+ + V K A +L ED++ Sbjct: 17 DNNVRDIVHVMLQTIEREGEEGVRRYAKKLDGWTGDIVLSDLDRKAACARVPVELKEDIQ 76 Query: 75 DALETARERIEAFYREEARGGFLRAE--GGGVLAQLVRPLERVGVYVPGGSAPLLSTLLM 132 A R EA ++A G E G + Q P+ G YVPGG +++ LM Sbjct: 77 FAHANIRRFAEA---QKATMGECEIEVIPGLIAGQKQIPVSSAGCYVPGGRYSHVASALM 133 Query: 133 TVVPAKVAGVREVIVASPPKVHPGV----LAAAWVAGADRLFAMGGAQAIAALAYGTGRV 188 TV AKVAGV+ + SP + G+ + A ++GAD + +GG QAIAA+A G Sbjct: 134 TVTTAKVAGVQHITAVSPTRPETGIPDPIVYAMDLSGADLILNVGGVQAIAAMAQGLFGA 193 Query: 189 PRVDKIVGPGNRYVVAAKRLVYGTVGIDGLAGPTETMIIADGSASPRLLAADLLAQAEHG 248 D +VGPGN YV AKR+++G+VGID AGPT++++IAD +A +A DL++QAEHG Sbjct: 194 KPADILVGPGNSYVAEAKRMLFGSVGIDMFAGPTDSLVIADNTAEVETVAWDLVSQAEHG 253 Query: 249 PDSEPWLLSPDRALLERVEAELSWQLQDL--PRAEVARQA-LEKGGLVLTKDLEEAFALA 305 DS WL++ D+ L + V ++ L P ARQA E+ ++L EEA ++ Sbjct: 254 ADSPVWLVTTDKDLAQGVMHRAQELIETLPEPNRSAARQAWAERAEVILAGSREEAAQVS 313 Query: 306 NLYAPEHLSLALSDPLPWLEKVQNAGGVFLGEGSPEALGDYIAGPSHVMPTSGTARFQGG 365 + YAPEHL + D WL ++ G +FLG+ + + GD +GP+HV+PTSG AR+ GG Sbjct: 314 DRYAPEHLQVQAEDLDWWLGRLSAYGSLFLGKETTVSFGDKTSGPNHVLPTSGAARYTGG 373 Query: 366 LAVRDFLKVIPVVGLSEGAARELAKKGALLARAEGLEGHARSLDLR 411 L+V F K + + A++ELA + A L+R EG+EGHA++ + R Sbjct: 374 LSVHKFTKTVTWQHCNAAASKELALRTARLSRTEGMEGHAKAAEQR 419 Lambda K H 0.318 0.137 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 429 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 412 Length of database: 421 Length adjustment: 31 Effective length of query: 381 Effective length of database: 390 Effective search space: 148590 Effective search space used: 148590 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate GFF2510 PGA1_c25490 (histidinol dehydrogenase HisD)
to HMM TIGR00069 (hisD: histidinol dehydrogenase (EC 1.1.1.23))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00069.hmm # target sequence database: /tmp/gapView.20160.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00069 [M=393] Accession: TIGR00069 Description: hisD: histidinol dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-132 428.4 0.2 1.9e-132 428.2 0.2 1.0 1 lcl|FitnessBrowser__Phaeo:GFF2510 PGA1_c25490 histidinol dehydroge Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF2510 PGA1_c25490 histidinol dehydrogenase HisD # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 428.2 0.2 1.9e-132 1.9e-132 1 393 [] 24 419 .. 24 419 .. 0.98 Alignments for each domain: == domain 1 score: 428.2 bits; conditional E-value: 1.9e-132 TIGR00069 1 vkeiiedvrkeGdeAlleytekfdkvkleslrvseeeleealeavdeelkealelaaeniekfhekqlpes..vev 74 v+ +++ +++eG+e +++y++k+d+++ ++ +s+ + ++a ++v+ elke+++ a++ni++f+e+q+++ +e+ lcl|FitnessBrowser__Phaeo:GFF2510 24 VHVMLQTIEREGEEGVRRYAKKLDGWT-GDIVLSDLDRKAACARVPVELKEDIQFAHANIRRFAEAQKATMgeCEI 98 5668999*******************5.88*************************************988656899 PP TIGR00069 75 eteegvllgqkvrplervglYvPgGkaaypStvlmtavpAkvAgvkeivvvtPpkkdgkvnpavlaaakllgvdev 150 e +g ++gqk p++++g+YvPgG++++++++lmt+ +AkvAgv++i++v+P++ + + + +++a++l g+d + lcl|FitnessBrowser__Phaeo:GFF2510 99 EVIPGLIAGQKQIPVSSAGCYVPGGRYSHVASALMTVTTAKVAGVQHITAVSPTRPETGIPDPIVYAMDLSGADLI 174 99****************************************************99999***************** PP TIGR00069 151 ykvGGaqaiaalayGtetvpkvdkivGPGniyVtaAKklvfgevgidmiaGPsEvlviadesanpelvaaDllsqa 226 ++vGG+qaiaa+a G+ +++d++vGPGn+yV++AK+++fg+vgidm+aGP++ lviad++a+ e+va Dl+sqa lcl|FitnessBrowser__Phaeo:GFF2510 175 LNVGGVQAIAAMAQGLFGAKPADILVGPGNSYVAEAKRMLFGSVGIDMFAGPTDSLVIADNTAEVETVAWDLVSQA 250 **************************************************************************** PP TIGR00069 227 EHdedaqailvttseelaekveeeveeqleele..rkeiaekslekngaiilvddleealelsneyApEHLelqtk 300 EH++d+ ++lvtt+++la+ v ++ +e +e+l+ +++ a++++++++++il+ + eea+++s++yApEHL++q++ lcl|FitnessBrowser__Phaeo:GFF2510 251 EHGADSPVWLVTTDKDLAQGVMHRAQELIETLPepNRSAARQAWAERAEVILAGSREEAAQVSDRYAPEHLQVQAE 326 ********************************866799************************************** PP TIGR00069 301 dpeellkkiknaGsvflGeytpealgdyvaGpnhvLPTsgtArfasglsvedFlkrisvqelskealeelaeavek 376 d +l +++++Gs+flG+ t++++gd+++GpnhvLPTsg+Ar+++glsv++F+k++++q+++ +a +ela +++ lcl|FitnessBrowser__Phaeo:GFF2510 327 DLDWWLGRLSAYGSLFLGKETTVSFGDKTSGPNHVLPTSGAARYTGGLSVHKFTKTVTWQHCNAAASKELALRTAR 402 **************************************************************************** PP TIGR00069 377 laeaEgLeaHaeavevR 393 l+++Eg+e Ha+a+e+R lcl|FitnessBrowser__Phaeo:GFF2510 403 LSRTEGMEGHAKAAEQR 419 *************9988 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (393 nodes) Target sequences: 1 (421 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.82 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory