Align 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) (characterized)
to candidate GFF2847 PGA1_c28930 dihydrodipicolinate synthase DapA
Query= BRENDA::Q8UGL3 (294 letters) >FitnessBrowser__Phaeo:GFF2847 Length = 290 Score = 380 bits (975), Expect = e-110 Identities = 195/293 (66%), Positives = 228/293 (77%), Gaps = 3/293 (1%) Query: 1 MFKGSIPALITPFTDNGSVDEKAFAAHVEWQIAEGSNGLVPVGTTGESPTLSHDEHKRVV 60 MFKGS+PAL+TPF+ NG +D VEW I +GS LVPVGTTGESPTL+H+EH+ V+ Sbjct: 1 MFKGSMPALVTPFS-NGELDLDTLKRLVEWHIDQGSTALVPVGTTGESPTLTHEEHETVI 59 Query: 61 ELCIEVAAKRVPVIAGAGSNNTDEAIELALHAQEAGADALLVVTPYYNKPTQKGLFAHFS 120 +++AA RVPVIAGAGSNNT E A E GADA LVVTPYYNKPTQ+GL AHF+ Sbjct: 60 AEVVKIAAGRVPVIAGAGSNNTVEGKRFVQFAAEVGADAALVVTPYYNKPTQRGLIAHFT 119 Query: 121 AVAEAVKLPIVIYNIPPRSVVDMSPETMGALVKAHKNIIGVKDATGKLDRVSEQRISCGK 180 + +PIVIYNIP RSV+DM+P TMG L K + IIGVKDATG + RVS+QR SCG Sbjct: 120 ELHNCADIPIVIYNIPGRSVIDMTPATMGELAKLER-IIGVKDATGDIARVSQQRASCGA 178 Query: 181 DFVQLSGEDGTALGFNAHGGVGCISVTANVAPRLCSEFQAAMLAGDYAKALEYQDRLMPL 240 DF+QLSGED TALGFNAHGGVGCISVTANVAP+LC+EFQAA LAGDYA ALEYQD+LMPL Sbjct: 179 DFIQLSGEDATALGFNAHGGVGCISVTANVAPKLCAEFQAATLAGDYALALEYQDKLMPL 238 Query: 241 HRAIFMEPGVCGTKYALSKTRGGNRRVRSPLMSTLEPATEAAIDAALKHAGLM 293 H AIF+EPG+ G KY LSK + VR PL + LE +T+AAIDAA+ HAGL+ Sbjct: 239 HEAIFIEPGLAGAKYGLSKLGLCSEEVRLPL-TGLEDSTKAAIDAAMAHAGLL 290 Lambda K H 0.317 0.133 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 352 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 290 Length adjustment: 26 Effective length of query: 268 Effective length of database: 264 Effective search space: 70752 Effective search space used: 70752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate GFF2847 PGA1_c28930 (dihydrodipicolinate synthase DapA)
to HMM TIGR00674 (dapA: 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00674.hmm # target sequence database: /tmp/gapView.27188.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00674 [M=286] Accession: TIGR00674 Description: dapA: 4-hydroxy-tetrahydrodipicolinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-97 310.9 0.0 3.4e-97 310.7 0.0 1.0 1 lcl|FitnessBrowser__Phaeo:GFF2847 PGA1_c28930 dihydrodipicolinate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF2847 PGA1_c28930 dihydrodipicolinate synthase DapA # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 310.7 0.0 3.4e-97 3.4e-97 2 284 .. 5 285 .. 4 287 .. 0.98 Alignments for each domain: == domain 1 score: 310.7 bits; conditional E-value: 3.4e-97 TIGR00674 2 vltAliTPfkedgsvdfaalekliesqiekgvdaivvvGtTGEsatLsleEkkkvievavelvknrvpviaGtgsn 77 +++Al+TPf + + +d+++l++l+e +i++g+ a+v+vGtTGEs+tL++eE+++vi +v+++++rvpviaG+gsn lcl|FitnessBrowser__Phaeo:GFF2847 5 SMPALVTPFSNGE-LDLDTLKRLVEWHIDQGSTALVPVGTTGESPTLTHEEHETVIAEVVKIAAGRVPVIAGAGSN 79 789******9888.************************************************************** PP TIGR00674 78 ateeaieltkeaeklgvdgvlvvtPyYnkPtqeGlykhfkaiaeevelPiilYnvPsRtgvslepetvkrLaeeve 153 +t e +++++a+++g+d++lvvtPyYnkPtq+Gl++hf ++++++++Pi++Yn+P+R++++++p t+ +La+ ++ lcl|FitnessBrowser__Phaeo:GFF2847 80 NTVEGKRFVQFAAEVGADAALVVTPYYNKPTQRGLIAHFTELHNCADIPIVIYNIPGRSVIDMTPATMGELAKLER 155 **************************************************************************** PP TIGR00674 154 ivaiKeasgdlervseikaeakedfkvlsGdDaltleilalGakGviSVasnvapkelkemvkaalegdteearei 229 i+++K+a+gd++rvs+ +a ++df lsG+Da++l + a G+ G iSV++nvapk+++e+ +a+l+gd++ a+e lcl|FitnessBrowser__Phaeo:GFF2847 156 IIGVKDATGDIARVSQQRASCGADFIQLSGEDATALGFNAHGGVGCISVTANVAPKLCAEFQAATLAGDYALALEY 231 **************************************************************************** PP TIGR00674 230 hqkllklfkalfietNPipvKtalallgliekdelRlPLtelseekkeklkevlk 284 + kl++l++a+fie+ + K+ l lgl+ + e+RlPLt l++++k ++++++ lcl|FitnessBrowser__Phaeo:GFF2847 232 QDKLMPLHEAIFIEPGLAGAKYGLSKLGLCSE-EVRLPLTGLEDSTKAAIDAAMA 285 ********************************.*************999988775 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (286 nodes) Target sequences: 1 (290 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 6.65 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory