Align Histidinol-phosphate aminotransferase; EC 2.6.1.9; Imidazole acetol-phosphate transaminase (uncharacterized)
to candidate GFF2953 Psest_3009 L-threonine-O-3-phosphate decarboxylase
Query= curated2:A1S6Z2 (362 letters) >FitnessBrowser__psRCH2:GFF2953 Length = 329 Score = 77.0 bits (188), Expect = 6e-19 Identities = 77/263 (29%), Positives = 117/263 (44%), Gaps = 20/263 (7%) Query: 73 AAYAGVAAHELVCGRGADEAIELLIRTFCVPGQDSIGIFSPTYGMYAISAATFNVAVNTL 132 AA A L+ G+ AI+ L R + G +GI SP Y +A A + Sbjct: 57 AARQCYGARALLPVAGSQSAIQALPR---LRGSARVGIISPCYAEHA--EAWRRAGHRVV 111 Query: 133 PLAEDFSLPDDISALTGSKLVFVCNPNNPTGTLLPLGEIARVAKTFP--NALVVVDEAYI 190 L E S+P AL ++ V NPNNPTG L+ + +VVDEA++ Sbjct: 112 ELCEA-SVP---RALDQLDVLVVVNPNNPTGQLVAPQRLLEWRSDLAAYGGWLVVDEAFM 167 Query: 191 EFAHNADGSPAQSATSLMAEFENLVILRTLSKAFGLAGARCGFLLAKPSVCELVMRVIAP 250 D +P S + + L++LR+ K FGLAGAR GF+LA + + R++ P Sbjct: 168 ------DCTPEHSLAA-HSHLPGLIVLRSFGKFFGLAGARLGFVLAHAGLLRSLARLLGP 220 Query: 251 YPVPVPVSVIAEKALSVMGIAQMRADVVLLNKQGARLALALTEAGLSVLPSGGNYVLAFS 310 + V P +A + L+ Q + + L+ G RL L L+ L + S Sbjct: 221 WTVNGPTRQLAAELLADQSAQQRQRE--CLHCDGQRLVDLLRRHELAPLGGCALFQWWVS 278 Query: 311 NDVEVLARALTKAGIVARRYSHP 333 D +L L + GI+ R ++ P Sbjct: 279 ADAALLHDFLARRGILTRLFAQP 301 Lambda K H 0.319 0.134 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 270 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 329 Length adjustment: 29 Effective length of query: 333 Effective length of database: 300 Effective search space: 99900 Effective search space used: 99900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory