Align Chorismate synthase; CS; 5-enolpyruvylshikimate-3-phosphate phospholyase; EPSP phospholyase; EC 4.2.3.5 (characterized)
to candidate GFF3353 PGA1_c34060 chorismate synthase AroC
Query= SwissProt::P12008 (361 letters) >FitnessBrowser__Phaeo:GFF3353 Length = 368 Score = 409 bits (1052), Expect = e-119 Identities = 208/358 (58%), Positives = 265/358 (74%), Gaps = 8/358 (2%) Query: 1 MAGNTIGQLFRVTTFGESHGLALGCIVDGVPPGIPLTEADLQHDLDRRRPGTSRYTTQRR 60 M+ N+ G LFRVTT+GESHG ALG VDG PP +P+ LQ LD+RRPG ++ TQR Sbjct: 1 MSINSFGHLFRVTTWGESHGPALGATVDGCPPNVPVDAEMLQQWLDKRRPGQNKNMTQRN 60 Query: 61 EPDQVKILSGVFEGVTTGTSIGLLIENTDQRSQDYSAIKDVFRPGHADYTYEQKYGLRDY 120 EPD VKILSGVFEG +TGT I L+IENTDQRS+DY I FRPGHAD TY QKYG RDY Sbjct: 61 EPDAVKILSGVFEGKSTGTPIQLMIENTDQRSKDYGDIAQTFRPGHADITYFQKYGNRDY 120 Query: 121 RGGGRSSARETAMRVAAGAIAKKYL-AEKFGIEIRGCLTQMGDIPLDIK--DWSQVEQNP 177 RGGGRSSARETA RVAAG +A++ + A G+EI+G +T+MG++ +D DW ++QN Sbjct: 121 RGGGRSSARETAARVAAGGVAREAIKALVPGLEIKGYMTRMGEMEIDRSRFDWDAIDQND 180 Query: 178 FFCPDPDKIDALDELMRALKKEGDSIGAKVTVVASGVPAGLGEPVFDRLDADIAHALMSI 237 F+ PD + + ++ L+KE DS+GA + VVA GVPAG+G P++ +LD D+A A+MSI Sbjct: 181 FWIPDAAAVQDWENYLQGLRKEHDSVGAVIEVVARGVPAGIGAPIYGKLDTDLASAMMSI 240 Query: 238 NAVKGVEIGDGFDVVALRGSQNRDEI--TKDG---FQSNHAGGILGGISSGQQIIAHMAL 292 NAVK VEIG+G + L+GS+N DEI +DG + SNH+GGILGGIS+GQ ++ A+ Sbjct: 241 NAVKAVEIGEGMNAALLKGSENADEIFLGEDGQPVYSSNHSGGILGGISTGQDVVVRFAV 300 Query: 293 KPTSSITVPGRTINRFGEEVEMITKGRHDPCVGIRAVPIAEAMLAIVLMDHLLRQRAQ 350 KPTSSI P ++I + G E+ITKGRHDPCVGIRAVP+AEAM+A V++DHLL R Q Sbjct: 301 KPTSSILTPRQSIRKDGSAAEVITKGRHDPCVGIRAVPVAEAMMACVILDHLLLHRGQ 358 Lambda K H 0.319 0.138 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 433 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 368 Length adjustment: 29 Effective length of query: 332 Effective length of database: 339 Effective search space: 112548 Effective search space used: 112548 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate GFF3353 PGA1_c34060 (chorismate synthase AroC)
to HMM TIGR00033 (aroC: chorismate synthase (EC 4.2.3.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00033.hmm # target sequence database: /tmp/gapView.29664.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00033 [M=351] Accession: TIGR00033 Description: aroC: chorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.9e-136 438.5 0.1 9.1e-136 438.3 0.1 1.0 1 lcl|FitnessBrowser__Phaeo:GFF3353 PGA1_c34060 chorismate synthase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF3353 PGA1_c34060 chorismate synthase AroC # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 438.3 0.1 9.1e-136 9.1e-136 1 349 [. 10 357 .. 10 359 .. 0.98 Alignments for each domain: == domain 1 score: 438.3 bits; conditional E-value: 9.1e-136 TIGR00033 1 lrlttfGeSHgkalgaiidGlPaglelteediqkelkrRrpgqsrltrmrkEeDeveilsGvfeGkTtGaPialli 76 +r+tt+GeSHg+alga++dG+P+++++++e++q+ l++Rrpgq + ++r+E D+v+ilsGvfeGk tG+Pi l+i lcl|FitnessBrowser__Phaeo:GFF3353 10 FRVTTWGESHGPALGATVDGCPPNVPVDAEMLQQWLDKRRPGQNKNMTQRNEPDAVKILSGVFEGKSTGTPIQLMI 85 89************************************************************************** PP TIGR00033 77 kNkdvrskdyedikelpRPgHadytylkKYgikdregggrsSaReTaarvaaGavakklLketa.gieivayvvkl 151 +N+d+rskdy di++++RPgHad ty++KYg++d++gggrsSaReTaarvaaG va++ +k g+ei++y++++ lcl|FitnessBrowser__Phaeo:GFF3353 86 ENTDQRSKDYGDIAQTFRPGHADITYFQKYGNRDYRGGGRSSARETAARVAAGGVAREAIKALVpGLEIKGYMTRM 161 **********************************************************99986449********** PP TIGR00033 152 geveleeesakeiskerldkspvrcpdaeaekemeeeidkakkdgdsvGgvvevvvsnvpvglGeplfdkldaela 227 ge+e++++ ++ +++d++ + +pda a + e++++ ++k++dsvG+v+evv+++vp+g+G p++ kld+ la lcl|FitnessBrowser__Phaeo:GFF3353 162 GEMEIDRSRFDW---DAIDQNDFWIPDAAAVQDWENYLQGLRKEHDSVGAVIEVVARGVPAGIGAPIYGKLDTDLA 234 ******998884...79*********************************************************** PP TIGR00033 228 sallsinAvKgveiGdGFeaasvrGseanDelvle.ddkirrktnnsGGieGGitnGedirvriavKpiptikkpl 302 sa++sinAvK+veiG+G +aa +Gse De+ l d++ +n+sGGi+GGi++G+d++vr avKp+++i +p+ lcl|FitnessBrowser__Phaeo:GFF3353 235 SAMMSINAVKAVEIGEGMNAALLKGSENADEIFLGeDGQPVYSSNHSGGILGGISTGQDVVVRFAVKPTSSILTPR 310 *******************************998758888999********************************* PP TIGR00033 303 ktvdletkekakatkgRhDpcvvpravpvvEamvalvladallekra 349 +++ ++++ + +tkgRhDpcv +ravpv+Eam+a v++d+ll +r+ lcl|FitnessBrowser__Phaeo:GFF3353 311 QSIRKDGSAAEVITKGRHDPCVGIRAVPVAEAMMACVILDHLLLHRG 357 ******************************************99886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (368 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.65 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory