Align diaminopimelate decarboxylase (EC 4.1.1.20) (characterized)
to candidate GFF336 PGA1_c03470 diaminopimelate decarboxylase LysA
Query= reanno::Korea:Ga0059261_2051 (419 letters) >FitnessBrowser__Phaeo:GFF336 Length = 421 Score = 421 bits (1082), Expect = e-122 Identities = 221/422 (52%), Positives = 293/422 (69%), Gaps = 5/422 (1%) Query: 1 MDHFNRKNGVLHAENVSIPAIAAEVGTPVYVYSTATLERHASALKNALAGLPSVHLAFAI 60 MDHF ++G L+AE+V + IAA VGTP Y+YSTATL RH + +AL G+ + + +A+ Sbjct: 1 MDHFLYRDGALYAEDVPVAEIAATVGTPFYLYSTATLLRHFNLFDDALKGMDHL-VCYAM 59 Query: 61 KANPNLAVLGVLARQGYGADVVSGGELKRALAAGMPAEDVVFSGVGKTRAELQLGLDEGI 120 KA N A+L LA+ G G DVVS GE RA AAG+P + +VFSGVGKT+ E++ L GI Sbjct: 60 KAASNQAILKTLAQAGAGMDVVSQGEYLRAKAAGVPGDRIVFSGVGKTQDEIRTALSGGI 119 Query: 121 GQFNLELEEEGEVLADLAHAQGKTAPAVLRVNPDVDAGTHAKISTGKAENKFGVAIDRAL 180 QFN+E E E +V+ +A G AP +RVNPDVDA THAKI+TGK+ENKFG+ I RA Sbjct: 120 RQFNVESEPEMDVINAVALELGVVAPITVRVNPDVDAKTHAKIATGKSENKFGIPIARAR 179 Query: 181 EIFDRLAKRPGLNLRGVAIHIGSQLTELAPLEAAYKRVGELVAQLRAAGHTITHVDLGGG 240 E++ R A PGL + G+ +HIGSQLTELAP E AY++V EL QLRA GH I +DLGGG Sbjct: 180 EVYARAASLPGLKVIGIDVHIGSQLTELAPFELAYQKVAELTEQLRADGHDIHRLDLGGG 239 Query: 241 LGVPY-HAGQTVSTAEEFGAMVARVTQGWNVTLMFEPGRFICGNAGVLVTEVIWVKPAAG 299 LG+PY + T E+GAMV R + EPGR I GNAG++V++VI+VK Sbjct: 240 LGIPYTRSNDTPPLPVEYGAMVQRTLGHLGCEIEIEPGRLIAGNAGIMVSKVIYVKSGED 299 Query: 300 NPYVIVDAAMNDLARPALYDAYHEF-EAVEPTG--EKFVANIAGPVCETGDTFAMGREID 356 ++I+D AMNDL RPA+Y+AYH+ +EP+ E+ +I GPVCETGDTFA R++ Sbjct: 300 RDFLIIDGAMNDLIRPAMYEAYHDIVPVIEPSAGVEQRAYDIVGPVCETGDTFARHRDMP 359 Query: 357 VVKSGDLAVFRTAGAYGATMASTYNSRALVPEVLVSGDRFAVVADRIQPETIMGAERVPE 416 +++GDL FR+AGAYGA MAS YNSR L+PEVLV+GD+FAV+ R + ++ + +PE Sbjct: 360 PLEAGDLVAFRSAGAYGAVMASEYNSRPLIPEVLVNGDQFAVIRRRPDFDEMINRDTIPE 419 Query: 417 WV 418 W+ Sbjct: 420 WL 421 Lambda K H 0.318 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 537 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 419 Length of database: 421 Length adjustment: 32 Effective length of query: 387 Effective length of database: 389 Effective search space: 150543 Effective search space used: 150543 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate GFF336 PGA1_c03470 (diaminopimelate decarboxylase LysA)
to HMM TIGR01048 (lysA: diaminopimelate decarboxylase (EC 4.1.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01048.hmm # target sequence database: /tmp/gapView.23757.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01048 [M=417] Accession: TIGR01048 Description: lysA: diaminopimelate decarboxylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-147 476.5 0.0 3.3e-147 476.3 0.0 1.0 1 lcl|FitnessBrowser__Phaeo:GFF336 PGA1_c03470 diaminopimelate deca Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF336 PGA1_c03470 diaminopimelate decarboxylase LysA # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 476.3 0.0 3.3e-147 3.3e-147 5 416 .. 7 415 .. 4 416 .. 0.95 Alignments for each domain: == domain 1 score: 476.3 bits; conditional E-value: 3.3e-147 TIGR01048 5 kdgeleiegvdlkelaeefgtPlYvydeetlrerlealkeafkaeeslvlYAvKAnsnlavlrllaeeGlgldvvsg 81 +dg l++e+v+++e+a++ gtP+Y+y+++tl ++++ ++ a k+ ++lv+YA+KA sn a+l++la++G+g+dvvs+ lcl|FitnessBrowser__Phaeo:GFF336 7 RDGALYAEDVPVAEIAATVGTPFYLYSTATLLRHFNLFDDALKGMDHLVCYAMKAASNQAILKTLAQAGAGMDVVSQ 83 6899************************************************************************* PP TIGR01048 82 GEleralaAgvkaekivfsgngkseeeleaaleleiklinvdsveelelleeiakelgkkarvllRvnpdvdakthe 158 GE ra+aAgv+ ++ivfsg+gk+++e+++al+ +i+ +nv+s+ e++ ++++a elg a++++Rvnpdvdakth lcl|FitnessBrowser__Phaeo:GFF336 84 GEYLRAKAAGVPGDRIVFSGVGKTQDEIRTALSGGIRQFNVESEPEMDVINAVALELGVVAPITVRVNPDVDAKTHA 160 ***************************************************************************** PP TIGR01048 159 yisTGlkesKFGieveeaeeayelalkleslelvGihvHIGSqildlepfveaaekvvklleelkeegieleeldlG 235 +i+TG+ e+KFGi +++a+e+y +a++l+ l+++Gi+vHIGSq+++l+pf+ a +kv++l+e+l+++g +++ ldlG lcl|FitnessBrowser__Phaeo:GFF336 161 KIATGKSENKFGIPIARAREVYARAASLPGLKVIGIDVHIGSQLTELAPFELAYQKVAELTEQLRADGHDIHRLDLG 237 ***************************************************************************** PP TIGR01048 236 GGlgisyeeeeeapdle.eyaeklleklekeaelglklklilEpGRslvanagvlltrVesvKevesrkfvlvDagm 311 GGlgi+y++++++p l ey +++ ++l + l ++ +EpGR +++nag+++ +V +vK+ e r f ++D++m lcl|FitnessBrowser__Phaeo:GFF336 238 GGLGIPYTRSNDTPPLPvEYGAMVQRTLGH-----LGCEIEIEPGRLIAGNAGIMVSKVIYVKSGEDRDFLIIDGAM 309 ********9988776651555555444444.....6899************************************** PP TIGR01048 312 ndliRpalYeayheiaalkrlee.eetetvdvvGplCEsgDvlakdrelpeveeGdllavasaGAYgasmssnYnsr 387 ndliRpa+Yeayh+i+++ + ++ e+ +d+vGp+CE+gD++a+ r++p e+Gdl+a +saGAYga m+s+Ynsr lcl|FitnessBrowser__Phaeo:GFF336 310 NDLIRPAMYEAYHDIVPVIEPSAgVEQRAYDIVGPVCETGDTFARHRDMPPLEAGDLVAFRSAGAYGAVMASEYNSR 386 ****************99886651567889*********************************************** PP TIGR01048 388 prpaevlveegkarlirrretledllale 416 p + evlv++++ +irrr ++++++ + lcl|FitnessBrowser__Phaeo:GFF336 387 PLIPEVLVNGDQFAVIRRRPDFDEMINRD 415 ***********************999865 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (417 nodes) Target sequences: 1 (421 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.14 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory