Align Imidazole glycerol phosphate synthase subunit HisF; EC 4.3.2.10; IGP synthase cyclase subunit; IGP synthase subunit HisF; ImGP synthase subunit HisF; IGPS subunit HisF (uncharacterized)
to candidate Ga0059261_1047 Ga0059261_1047 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16)
Query= curated2:Q7W2X9 (269 letters) >FitnessBrowser__Korea:Ga0059261_1047 Length = 242 Score = 95.5 bits (236), Expect = 9e-25 Identities = 69/230 (30%), Positives = 112/230 (48%), Gaps = 21/230 (9%) Query: 18 IIPCLDVTAGRVVKGV--NFVNLTDAGD-PVEIARRYNEQGADELTFLDITATSDGHDLI 74 + P +D+ AG+VV+ + T G+ P A + + GA L +D+ A G + Sbjct: 3 VFPAIDLKAGQVVRLAEGDMTRATVYGENPAAQAEAFAKAGATHLHVVDLDAAFAGESIN 62 Query: 75 LPIIEQVASQVFIPLTVGGGVRQVSDVQRLLNAGADKISINSAAVANPELVRAAADYHGS 134 + + ++ + +GGG+R + V+R ++ G ++ I +AA+ +P+ VR AA H Sbjct: 63 GGAVAAILARFPGKVQLGGGIRNRASVERWIDMGVSRVVIGTAALEDPDFVREAAAAHPG 122 Query: 135 QCIVVAIDARRSSAEGEPARWEVFTHGGRKATGLDAVAWARRMAAYGAGEILLTSMDRDG 194 Q IVVA+DAR V T G + + R G +L T + RDG Sbjct: 123 Q-IVVAVDARDGF---------VATKGWADVSTVSIAELGHRFEDAGVAALLFTDVGRDG 172 Query: 195 TKSGFDLELTRAVSDAVPVPVIASGGVGNLQHL--------ADGVTTGRA 236 G ++E T A++ V +PVIASGGV ++ + +GV TGRA Sbjct: 173 LLKGCNVEATAALAAEVSIPVIASGGVADISDIHALAGKPGIEGVITGRA 222 Lambda K H 0.319 0.133 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 269 Length of database: 242 Length adjustment: 24 Effective length of query: 245 Effective length of database: 218 Effective search space: 53410 Effective search space used: 53410 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory