Align Branched-chain amino acid aminotransferase (EC 2.6.1.42) (characterized)
to candidate H281DRAFT_04193 H281DRAFT_04193 branched chain amino acid aminotransferase apoenzyme
Query= reanno::BFirm:BPHYT_RS16285 (307 letters) >FitnessBrowser__Burk376:H281DRAFT_04193 Length = 307 Score = 610 bits (1574), Expect = e-179 Identities = 301/307 (98%), Positives = 304/307 (99%) Query: 1 MSMADRDGKIWMDGKLIDWRDAKIHVLTHTLHYGMGVFEGVRAYKTADGGTAIFRLQEHT 60 MSMADRDGKIWMDGKLIDWRDAKIHVLTHTLHYGMGVFEGVRAYKTADGGTAIFRLQEHT Sbjct: 1 MSMADRDGKIWMDGKLIDWRDAKIHVLTHTLHYGMGVFEGVRAYKTADGGTAIFRLQEHT 60 Query: 61 KRLLNSAKIFQMDVPFDHETLAAAQCEVVRENKLESCYLRPIIWVGSEKLGVSAKGNTIH 120 KRLLNSAKIFQMDVPFDHETLAAAQ EVVRENKLESCYLRPIIWVGSEKLGVSAKGNTIH Sbjct: 61 KRLLNSAKIFQMDVPFDHETLAAAQREVVRENKLESCYLRPIIWVGSEKLGVSAKGNTIH 120 Query: 121 VAIAAWPWGAYLGEDGIAKGIRVKTSSFTRHHVNVSMVRAKASGWYVNSILANQEAIADG 180 VAIAAWPWGAYLGEDGIAKGIRVKTSSFTRHHVNVSMVRAKASGWYVNSILANQEAIADG Sbjct: 121 VAIAAWPWGAYLGEDGIAKGIRVKTSSFTRHHVNVSMVRAKASGWYVNSILANQEAIADG 180 Query: 181 YDEALLLDVDGYVSEGSGENFFLVNNGKLYTPDLSSCLDGITRDTVITLARDAGIQVIEK 240 YDEALLLDVDGYVSEGSGENFFLVNNGKLYTPDLSSCLDGITRDTVITLARD GI VIEK Sbjct: 181 YDEALLLDVDGYVSEGSGENFFLVNNGKLYTPDLSSCLDGITRDTVITLARDMGIPVIEK 240 Query: 241 RITRDEVYTCDEAFFTGTAAEVTPIRELDNRTIGSGARGPITEKLQSGFFDIVNGKSDKY 300 RITRDEVYTCDEAFFTGTAAEVTPIRELDNRTIG+GARGPITEKLQSGFFDIVNGKS+KY Sbjct: 241 RITRDEVYTCDEAFFTGTAAEVTPIRELDNRTIGAGARGPITEKLQSGFFDIVNGKSEKY 300 Query: 301 ANWLTKI 307 A+WLTKI Sbjct: 301 AHWLTKI 307 Lambda K H 0.319 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 539 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 307 Length adjustment: 27 Effective length of query: 280 Effective length of database: 280 Effective search space: 78400 Effective search space used: 78400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate H281DRAFT_04193 H281DRAFT_04193 (branched chain amino acid aminotransferase apoenzyme)
to HMM TIGR01122 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01122.hmm # target sequence database: /tmp/gapView.19975.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01122 [M=298] Accession: TIGR01122 Description: ilvE_I: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.5e-141 454.5 0.0 8.3e-141 454.4 0.0 1.0 1 lcl|FitnessBrowser__Burk376:H281DRAFT_04193 H281DRAFT_04193 branched chain a Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Burk376:H281DRAFT_04193 H281DRAFT_04193 branched chain amino acid aminotransferase apoenzyme # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 454.4 0.0 8.3e-141 8.3e-141 1 298 [] 11 307 .] 11 307 .] 0.99 Alignments for each domain: == domain 1 score: 454.4 bits; conditional E-value: 8.3e-141 TIGR01122 1 wldGelvdvedakvhvlthalhYGtgvfeGiRaYetdk.glaifrlkehveRlydsakilrleipy 65 w+dG+l+d++dak+hvlth+lhYG+gvfeG+RaY+t + g+aifrl+eh++Rl++saki+++++p+ lcl|FitnessBrowser__Burk376:H281DRAFT_04193 11 WMDGKLIDWRDAKIHVLTHTLHYGMGVFEGVRAYKTADgGTAIFRLQEHTKRLLNSAKIFQMDVPF 76 9**********************************987689************************* PP TIGR01122 66 skeelvevtkevlrknnlksaYiRplvyvGaedlglkpkvdlkveviiaawewgaylgeealekGi 131 +e+l +++ev+r+n+l+s+Y+Rp+++vG+e+lg+++k + +++v+iaaw+wgaylge+++ kGi lcl|FitnessBrowser__Burk376:H281DRAFT_04193 77 DHETLAAAQREVVRENKLESCYLRPIIWVGSEKLGVSAKGN-TIHVAIAAWPWGAYLGEDGIAKGI 141 **************************************655.9*********************** PP TIGR01122 132 kvkvssfrraavnsiptkakaagnYlnsllaksealraGydeailLdeeGyvaeGsGenifivkdg 197 +vk+ssf+r++vn+ + +aka+g Y+ns+la++ea++ Gydea+lLd +Gyv+eGsGen+f+v++g lcl|FitnessBrowser__Burk376:H281DRAFT_04193 142 RVKTSSFTRHHVNVSMVRAKASGWYVNSILANQEAIADGYDEALLLDVDGYVSEGSGENFFLVNNG 207 ****************************************************************** PP TIGR01122 198 vlltPpvsesiLkgitrdaviklakelgievkeerisreelytaDevfltGtaaevtPirevDgrk 263 +l+tP++ +s+L+gitrd+vi+la+++gi v e+ri+r+e+yt De+f+tGtaaevtPire+D+r+ lcl|FitnessBrowser__Burk376:H281DRAFT_04193 208 KLYTPDL-SSCLDGITRDTVITLARDMGIPVIEKRITRDEVYTCDEAFFTGTAAEVTPIRELDNRT 272 *******.88******************************************************** PP TIGR01122 264 igegkrGpvtkklqeaffdlvegktekkeewltyv 298 ig+g rGp+t+klq+ ffd+v+gk ek+++wlt++ lcl|FitnessBrowser__Burk376:H281DRAFT_04193 273 IGAGARGPITEKLQSGFFDIVNGKSEKYAHWLTKI 307 ********************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (307 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.19 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory