Align 2-isopropylmalate synthase 2; EC 2.3.3.13; Alpha-IPM synthase 2; Alpha-isopropylmalate synthase 2 (uncharacterized)
to candidate HSERO_RS14210 HSERO_RS14210 homocitrate synthase
Query= curated2:Q8RCF9 (384 letters) >FitnessBrowser__HerbieS:HSERO_RS14210 Length = 376 Score = 344 bits (883), Expect = 2e-99 Identities = 175/360 (48%), Positives = 235/360 (65%) Query: 9 VYIVDTTLRDGEQTAGVVFANNEKIRIAQMLDEIGIDQLEVGIPTMGGDEKETVAKIAKL 68 V I DTTLRDGEQTAGV F EKI IA+ LDEIG+ ++E+GIP MG E E + IA L Sbjct: 2 VTINDTTLRDGEQTAGVAFTAEEKIDIARALDEIGVPEMEIGIPIMGQAEIEVIQAIAAL 61 Query: 69 GLKASIMAWNRAVVKDVQESLECGVDAVAISISTSDIHIEHKLKKTRQWVLDSMTEAVRF 128 L++ M W R D+ + C D V +S+ SDIHI+HKL++ R WVL + + Sbjct: 62 PLRSKTMVWGRMCEADLAAAARCNADIVNLSMPVSDIHIQHKLQRDRDWVLAQIRHFLPK 121 Query: 129 AKKEGVYVSVNAEDASRTDMNFLIEFARCAKQAGADRLRFCDTVGFLDPFKTYEMVKAIK 188 A G+ V + ED+SR D++F++ A+ AGA R RF DT+G LDPF TYE+++ ++ Sbjct: 122 ALDLGMEVCLGGEDSSRADLDFMLRVIETAQAAGARRFRFADTLGLLDPFATYEVIRQLR 181 Query: 189 DAVDIEIEMHTHNDFGMATANALAGVKAGAKFVGVTVNGLGERAGNAALEEVVMALKYVY 248 VDIE+EMH HND G+ATAN LA + AGA V TVNGLGERAGNA LEEVVM L++++ Sbjct: 182 QEVDIELEMHAHNDLGLATANTLAAINAGASHVNTTVNGLGERAGNAPLEEVVMGLRHLH 241 Query: 249 KMDLGIDTSRFREISEYVALASGRPLPPSKAIVGKNVFAHESGIHVDGALKNPYTYEVFD 308 ++ +DT IS VA ASG+ + P+K+IVG+ VF HESGIHVDG LKNP YE F Sbjct: 242 GIETQVDTRSLPAISRLVAKASGKAVAPNKSIVGEAVFTHESGIHVDGLLKNPANYEHFS 301 Query: 309 PQEVGLERQIVIGKHSGTAALINKFKEYGRVLTEEEANLLLPHVRKMAIQLKRPLFDKEL 368 P E+G IV+GKHSG+ + + F + G +L++ +A +L +R + K + EL Sbjct: 302 PAELGRSHHIVLGKHSGSRGVKDAFAKMGILLSDSQAQAMLMRIRDHTMVAKAAPSEDEL 361 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 340 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 376 Length adjustment: 30 Effective length of query: 354 Effective length of database: 346 Effective search space: 122484 Effective search space used: 122484 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory