Align candidate HSERO_RS21740 HSERO_RS21740 (methionine synthase)
to HMM PF02965 (Met_synt_B12)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/PF02965.21.hmm # target sequence database: /tmp/gapView.19915.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: Met_synt_B12 [M=273] Accession: PF02965.21 Description: Vitamin B12 dependent methionine synthase, activation domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-127 410.6 0.1 4.3e-127 409.2 0.0 1.8 2 lcl|FitnessBrowser__HerbieS:HSERO_RS21740 HSERO_RS21740 methionine synthas Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS21740 HSERO_RS21740 methionine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.2 0.1 0.48 0.48 86 109 .. 906 929 .. 891 930 .. 0.63 2 ! 409.2 0.0 4.3e-127 4.3e-127 2 273 .] 958 1233 .. 957 1233 .. 0.98 Alignments for each domain: == domain 1 score: -4.2 bits; conditional E-value: 0.48 Met_synt_B12 86 elatlhtLrqqaekeegkpnlcla 109 a ++ +r+q+++++ +p l+la lcl|FitnessBrowser__HerbieS:HSERO_RS21740 906 LNADYERIREQHASKKAAPMLSLA 929 344567788888888888888876 PP == domain 2 score: 409.2 bits; conditional E-value: 4.3e-127 Met_synt_B12 2 leelveyidWtpffqaWelkgkypkiledekvgeeakklfkdAqamLkkiieekllkakavvglfp 67 l l++yidW pffq+W+l+g yp+il+de+vge+a+k+f++AqamLkkii+ ++l+a++v+ l+p lcl|FitnessBrowser__HerbieS:HSERO_RS21740 958 LGLLANYIDWGPFFQTWDLAGPYPAILTDEVVGEAATKVFQEAQAMLKKIIDGRWLTANGVISLLP 1023 56689************************************************************* PP Met_synt_B12 68 Anseg.ddievyadesrseelatlhtLrqqaeke....egkpnlclaDfvapkesgvkDyiGlFav 128 An+++ ddie+y+d+srs+++ t++ Lrqq+ek+ +pn cl+Df+apkesgv+DyiG+Fav lcl|FitnessBrowser__HerbieS:HSERO_RS21740 1024 ANTVNdDDIEIYTDDSRSQVAFTYYGLRQQTEKPvvdgVARPNQCLSDFIAPKESGVQDYIGMFAV 1089 ***96388*************************99888899************************* PP Met_synt_B12 129 taglgieelakefeaekddYsailvkaladrLaeAfaellhekvrkelWgyakdeklsneelikek 194 taglgie++ k+fe+++ddYs+i++kaladrLaeAfae+lhe+vrk+lWgya+de+ls ++likek lcl|FitnessBrowser__HerbieS:HSERO_RS21740 1090 TAGLGIEKYEKRFEDAHDDYSSIMLKALADRLAEAFAEYLHERVRKDLWGYAADENLSSTDLIKEK 1155 ****************************************************************** PP Met_synt_B12 195 YqgiRpApGYpacpdhtekktlfelldaeekigieLteslamtPaasvsGlyfahpearyFavgki 260 Y giRpApGYpacp+ht k+++f+ ++++e ig++Ltes+am P asvsG+yfahp+++yF vgki lcl|FitnessBrowser__HerbieS:HSERO_RS21740 1156 YLGIRPAPGYPACPEHTVKADVFRTMQCDE-IGMQLTESYAMFPGASVSGFYFAHPQSKYFVVGKI 1220 ******************************.*********************************** PP Met_synt_B12 261 ekdqvedyakrkg 273 ++dqv d+a+r++ lcl|FitnessBrowser__HerbieS:HSERO_RS21740 1221 GEDQVVDMAERRH 1233 ***********95 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (273 nodes) Target sequences: 1 (1247 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 19.09 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory