Align class I fructose-bisphosphate aldolase/sedoheptulose-1,7-bisphosphate aldolase monomer (EC 4.1.2.13) (characterized)
to candidate NP_149228.1 CA_P0064 fructose-1,6-bisphosphate aldolase
Query= metacyc::FBABSYN-MONOMER (300 letters) >NCBI__GCF_000008765.1:NP_149228.1 Length = 295 Score = 343 bits (880), Expect = 3e-99 Identities = 177/294 (60%), Positives = 223/294 (75%) Query: 7 NQEQLKKMKSHPGFIAALDQSGGSTPGALADYGIEPNTYSGDDQMFALVHQMRTRIMTSP 66 N+ Q+ ++ GFIAALDQSGGSTP AL YGI+ N+YS D++MF LVH+MR RI+ S Sbjct: 2 NETQMNRISKDKGFIAALDQSGGSTPKALLQYGIKENSYSNDEEMFNLVHEMRKRIIKST 61 Query: 67 GFTGDRILAAILFEDTMNREVDGEPTANYLWQNKQIVPILKVDKGLAQEKDGSQLMKPIP 126 F IL AILFE+TM R +D + TA+YLW K IVP LK+DKGL++ ++G QLMKPI Sbjct: 62 AFNSKYILGAILFENTMYRTIDHKYTADYLWNEKNIVPFLKIDKGLSELENGVQLMKPIT 121 Query: 127 QLDSLLMKAKKKGIFGTKMRSFIKHANPAGIEAIVDQQFELAQQIIAAGLVPIIEPEVDI 186 LD LL A +K IFGTKMRSFIK AN GI+ +VDQQFELA +I GLVPIIEPEVDI Sbjct: 122 NLDELLKAAIEKNIFGTKMRSFIKEANSKGIKMVVDQQFELADKIANQGLVPIIEPEVDI 181 Query: 187 HCSEKAQAEALLKQAMLKHLNQLPKGQWVMLKLTLPEQDNLYSNCIEHANVLRVVALSGG 246 ++K ++E LLK + KHL+ L K VMLKL++P +DN YS+ ++ +V+R+VALSGG Sbjct: 182 KSTDKEKSEELLKLEISKHLSDLDKETKVMLKLSIPTKDNFYSDLMKDPHVVRIVALSGG 241 Query: 247 YSQAEANERLSRNHGVIASFSRALTEGLTAQQTDAEFNTMLDESIEKIYQASIT 300 YSQ+EANERLSRN+G+IASFSRAL+E L+ QTD EFN L SI++IY+ASIT Sbjct: 242 YSQSEANERLSRNNGLIASFSRALSENLSIDQTDEEFNETLSNSIKEIYEASIT 295 Lambda K H 0.316 0.132 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 270 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 295 Length adjustment: 26 Effective length of query: 274 Effective length of database: 269 Effective search space: 73706 Effective search space used: 73706 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory