Align D-3-phosphoglycerate dehydrogenase; PGDH; EC 1.1.1.95 (uncharacterized)
to candidate NP_346734.1 CA_C0089 D-2-hydroxyacid dehydrogenase
Query= curated2:O29445 (527 letters) >NCBI__GCF_000008765.1:NP_346734.1 Length = 318 Score = 193 bits (490), Expect = 9e-54 Identities = 124/314 (39%), Positives = 176/314 (56%), Gaps = 10/314 (3%) Query: 1 MKVLVAEP--ISEEAIDYMRKN----GLEVEVKTGMSRE-ELIREVPKYEAIVVRSQTKV 53 M++ V EP ISEE I + K G E+ + S + +++E K ++V + + Sbjct: 1 MRISVIEPLGISEEEIRSIAKTITDRGHEIVIYNEKSTDTNVLKERVKDSEVIVLANMPL 60 Query: 54 DAEVIQAAKNLKIIGRAGVGVDNIDINAATQRGIVVVNAPGGNTISTAEHAIALMLAAAR 113 AEVI + LK++ A GVD+++++A + +VV NA G +T S E L+ + R Sbjct: 61 KAEVINSDSKLKMMSIAFTGVDHVELSALNNKEVVVSNASGYSTESVTELTFGLVFSVLR 120 Query: 114 KIPQADRSVKEGKWERKKFMGIELRGKTAGVIGLGRVGFEVAKRCKALEMNVLAYDPFVS 173 I D+ +EGK + F +L GKT GVIG G +G V + KA V+AY Sbjct: 121 NIVPLDKVTREGK-TKNGFSQSDLSGKTFGVIGTGLIGASVCRIAKAFGCKVIAYSRS-K 178 Query: 174 KERAEQIGVKLVDFDTLLASSDVITVHVPRTKETIGLIGKGQFEKMKDGVIVVNAARGGI 233 KE E IGV V D LLA SDVI+VHVP+T+ETIG+I K + + MK I++N ARG I Sbjct: 179 KEELEVIGVNYVTLDELLAKSDVISVHVPQTQETIGMISKEKIKLMKKTAILINVARGPI 238 Query: 234 VDEAALYEAIKAGKVAAAALDVYEKEPP-SPDNPLLKLDNVVTTPHIAASTREAQLNVGM 292 VD AL EA++ G +A A +DV++KEPP LLK N V PH+ +T+EA + Sbjct: 239 VDNEALAEALENGTIAGAGIDVFDKEPPLDLGYRLLKAPNTVVLPHVGFATKEAMVRRAH 298 Query: 293 IIAEDIVNMAKGLP 306 I E+IV G P Sbjct: 299 ITFENIVKWLDGTP 312 Lambda K H 0.317 0.136 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 388 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 527 Length of database: 318 Length adjustment: 31 Effective length of query: 496 Effective length of database: 287 Effective search space: 142352 Effective search space used: 142352 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory