Align ornithine carbamoyltransferase (EC 2.1.3.3) (characterized)
to candidate NP_346957.1 CA_C0316 ornithine carbomoyltransferase
Query= metacyc::ORNCARBAMTRANSFERST-MONOMER (332 letters) >NCBI__GCF_000008765.1:NP_346957.1 Length = 333 Score = 409 bits (1050), Expect = e-119 Identities = 197/330 (59%), Positives = 259/330 (78%), Gaps = 2/330 (0%) Query: 5 LKGRSFLTLKHFTPEEINYLLDLSADLKAKKRAGIKGNLLEGKNVVLLFEKTSTRTRCAF 64 LK R+FL+L FTP++INY+LDL+ LK KR G++ L+ KN+ L+FEK STRTRC+F Sbjct: 4 LKNRNFLSLMDFTPQDINYMLDLAKKLKEDKRNGLEEQYLKKKNIALIFEKDSTRTRCSF 63 Query: 65 EVGVLDEGGHVTFLGSGDSQMGKKESIEDTAKVLGRFYDGIEFRGFKQETVEILAANAGV 124 EV D+G H ++GS SQ+ KKESI+DTA+VLGR +D IE+RG+ QE VEILA ++ V Sbjct: 64 EVAAHDQGAHAVYIGSTGSQISKKESIKDTARVLGRMFDAIEYRGYGQEVVEILAEHSNV 123 Query: 125 PVWNGLTDLYHPTQILADFLTIKEHVAKPLNKVKFVYAGDARNNMGNSLMIGAAKMGMEF 184 PVWNGLTD HPTQ++A+F+T+KE KPLN++KFVY GDARNN+ N+LMIGAAKMGM+F Sbjct: 124 PVWNGLTDEEHPTQVIANFMTLKEKFNKPLNEIKFVYCGDARNNVSNALMIGAAKMGMDF 183 Query: 185 WGLAPKELWPSEELVAEMKEVAKETGASINFSENVDD-VKNADVIYTDVWVSMGEE-AMF 242 APK L+PS ELV + ++A+ TG I S+ VD+ V ADV+YTDVWVSMGE+ ++ Sbjct: 184 RIAAPKSLFPSSELVKKCMDIAELTGGKITLSDEVDEAVFGADVLYTDVWVSMGEDREVW 243 Query: 243 EERIKQLKPYQVNMDMIKKTENPDVLFLHCLPAFHDLNTTVGKDIYEKFGLESMEVTDEV 302 +ER+K LKPYQ+NM+MI KT+NP+V F+HCLPAFHD +T K+IY++F EVTDEV Sbjct: 244 KERLKMLKPYQINMEMISKTKNPNVKFMHCLPAFHDFSTDAAKEIYDEFNEIPFEVTDEV 303 Query: 303 FRSRHSKVFDEAENRMHTIKAVMVATIGNL 332 F S +S FDEAENR+H+IKA+MVAT+G++ Sbjct: 304 FESDYSLAFDEAENRLHSIKAIMVATLGDI 333 Lambda K H 0.317 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 357 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 333 Length adjustment: 28 Effective length of query: 304 Effective length of database: 305 Effective search space: 92720 Effective search space used: 92720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate NP_346957.1 CA_C0316 (ornithine carbomoyltransferase)
to HMM TIGR00658 (argF: ornithine carbamoyltransferase (EC 2.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00658.hmm # target sequence database: /tmp/gapView.7031.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00658 [M=304] Accession: TIGR00658 Description: orni_carb_tr: ornithine carbamoyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-132 426.9 0.2 2.3e-132 426.8 0.2 1.0 1 lcl|NCBI__GCF_000008765.1:NP_346957.1 CA_C0316 ornithine carbomoyltran Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000008765.1:NP_346957.1 CA_C0316 ornithine carbomoyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 426.8 0.2 2.3e-132 2.3e-132 1 303 [. 7 330 .. 7 331 .. 0.99 Alignments for each domain: == domain 1 score: 426.8 bits; conditional E-value: 2.3e-132 TIGR00658 1 rhllslldlseeelkellelakklkkekkkgkeekklkgktlaliFekrstRtRvsfevaayelGaqvlyln 72 r++lsl+d+++++++++l+lakklk++k++g ee++lk+k++aliFek+stRtR+sfevaa ++Ga+++y++ lcl|NCBI__GCF_000008765.1:NP_346957.1 7 RNFLSLMDFTPQDINYMLDLAKKLKEDKRNGLEEQYLKKKNIALIFEKDSTRTRCSFEVAAHDQGAHAVYIG 78 789********************************************************************* PP TIGR00658 73 keelqlgrkesikDtarvlsryvdaivvRvykhedveelakyasvPvingLtdlehPcqilaDlltikeklg 144 + +q+++kesikDtarvl+r++dai +R+y +e ve la++++vPv+ngLtd+ehP+q++a+++t+kek++ lcl|NCBI__GCF_000008765.1:NP_346957.1 79 STGSQISKKESIKDTARVLGRMFDAIEYRGYGQEVVEILAEHSNVPVWNGLTDEEHPTQVIANFMTLKEKFN 150 ************************************************************************ PP TIGR00658 145 .klkevklvyvGDa.nnvanslllaaaklGldvvvatPeglepeaeivkkakkiakenggkleltedpkkav 214 l+e+k+vy GDa nnv n l+++aak+G+d+++a+P+ l p++e+vkk+ +ia+ +ggk++l +++++av lcl|NCBI__GCF_000008765.1:NP_346957.1 151 kPLNEIKFVYCGDArNNVSNALMIGAAKMGMDFRIAAPKSLFPSSELVKKCMDIAELTGGKITLSDEVDEAV 222 99********************************************************************** PP TIGR00658 215 kdadviytDvwvsmGe.eekkeerlkllkpyqvneellela.kpevkflhCLPavr................ 268 +adv+ytDvwvsmGe e ++erlk+lkpyq+n+e+++ + +p+vkf+hCLPa++ lcl|NCBI__GCF_000008765.1:NP_346957.1 223 FGADVLYTDVWVSMGEdREVWKERLKMLKPYQINMEMISKTkNPNVKFMHCLPAFHdfstdaakeiydefne 294 ****************66789*******************999***************************** PP TIGR00658 269 .GeevtdevlegeasivfdeaenRlhaqkavlkall 303 evtdev+e++ s+ fdeaenRlh++ka+++a+l lcl|NCBI__GCF_000008765.1:NP_346957.1 295 iPFEVTDEVFESDYSLAFDEAENRLHSIKAIMVATL 330 99*******************************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (333 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.79 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory