Align Chorismate synthase; CS; 5-enolpyruvylshikimate-3-phosphate phospholyase; EPSP phospholyase; EC 4.2.3.5 (characterized)
to candidate NP_347532.1 CA_C0896 chorismate synthase
Query= SwissProt::P12008 (361 letters) >NCBI__GCF_000008765.1:NP_347532.1 Length = 356 Score = 259 bits (662), Expect = 8e-74 Identities = 147/350 (42%), Positives = 214/350 (61%), Gaps = 15/350 (4%) Query: 7 GQLFRVTTFGESHGLALGCIVDGVPPGIPLTEADLQHDLDRRRPGTSRYTTQRREPDQVK 66 G +++ FGESHG A+G +++G+ PG+ L + +++RR PG ++Y+TQR E D + Sbjct: 6 GNKIKLSIFGESHGKAIGIVINGLEPGVELDLEFINSEMERRAPGRTKYSTQRNEKDNFE 65 Query: 67 ILSGVFEGVTTGTSIGLLIENTDQRSQDYSAIKDVFRPGHADYTYEQKY-GLRDYRGGGR 125 I+SG F G TTGT + +I N +Q S+DYS +KD RPGH+DYT KY G DYRGGG Sbjct: 66 IVSGFFNGKTTGTPLCAIIWNGNQHSKDYSNVKDFARPGHSDYTGFIKYKGFNDYRGGGH 125 Query: 126 SSARETAMRVAAGAIAKKYLAEKFGIEIRGCLTQMGD--------IPLDIKDWSQVEQNP 177 S R TA V AGA+AK+ L K I I + + D + +D + + + Sbjct: 126 FSGRLTAPLVFAGAVAKQILF-KDNIIIGSHILSIKDTKEKYFDKVNIDSETLISLTKKA 184 Query: 178 FFCPDPDKIDALDELMRALKKEGDSIGAKVTVVASGVPAGLGEPVFDRLDADIAHALMSI 237 F D K + + E++ K + DS+G + A +PAG G+P FD ++ ++H L SI Sbjct: 185 FPVLDDKKGEEMKEVILKAKNDLDSVGGIIECCALNLPAGKGDPFFDSCESILSHMLFSI 244 Query: 238 NAVKGVEIGDGFDVVALRGSQ-NRDEITKDGF---QSNHAGGILGGISSGQQIIAHMALK 293 AVKGVE G+GF++ ++GS+ N D TK+G SN+ GGILGGI+SG ++ A K Sbjct: 245 PAVKGVEFGEGFNITKMKGSEANDDFYTKNGIVKTYSNNNGGILGGITSGMPLVFRAAFK 304 Query: 294 PTSSITVPGRTIN-RFGEEVEMITKGRHDPCVGIRAVPIAEAMLAIVLMD 342 PT+SI P +TIN + E E+ KGRHDPC+ +RAVP+ EA A+ ++D Sbjct: 305 PTASIYKPQKTINMKTMENEEISIKGRHDPCIVLRAVPVVEAACALSILD 354 Lambda K H 0.319 0.138 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 334 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 356 Length adjustment: 29 Effective length of query: 332 Effective length of database: 327 Effective search space: 108564 Effective search space used: 108564 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate NP_347532.1 CA_C0896 (chorismate synthase)
to HMM TIGR00033 (aroC: chorismate synthase (EC 4.2.3.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00033.hmm # target sequence database: /tmp/gapView.6581.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00033 [M=351] Accession: TIGR00033 Description: aroC: chorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-124 400.7 0.0 2.7e-124 400.6 0.0 1.0 1 lcl|NCBI__GCF_000008765.1:NP_347532.1 CA_C0896 chorismate synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000008765.1:NP_347532.1 CA_C0896 chorismate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 400.6 0.0 2.7e-124 2.7e-124 2 343 .. 10 355 .. 9 356 .] 0.95 Alignments for each domain: == domain 1 score: 400.6 bits; conditional E-value: 2.7e-124 TIGR00033 2 rlttfGeSHgkalgaiidGlPaglelteediqkelkrRrpgqsrltrmrkEeDeveilsGvfeGkTtGaPia 73 +l +fGeSHgka+g +i+Gl +g+el+ e i++e++rR pg ++++++r+E+D++ei+sG f+GkTtG+P++ lcl|NCBI__GCF_000008765.1:NP_347532.1 10 KLSIFGESHGKAIGIVINGLEPGVELDLEFINSEMERRAPGRTKYSTQRNEKDNFEIVSGFFNGKTTGTPLC 81 789********************************************************************* PP TIGR00033 74 llikNkdvrskdyedikelpRPgHadytylkKYgikd.regggrsSaReTaarvaaGavakklLketagiei 144 +i N +++skdy+++k++ RPgH+dyt++ KY+ + ++ggg S+R Ta +v aGavak+ L + ++i i lcl|NCBI__GCF_000008765.1:NP_347532.1 82 AIIWNGNQHSKDYSNVKDFARPGHSDYTGFIKYKGFNdYRGGGHFSGRLTAPLVFAGAVAKQILFK-DNIII 152 *********************************85544**************************99.99*** PP TIGR00033 145 vayvvklge.veleeesak..eiskerldkspvrcpdaeaekemeeeidkakkdgdsvGgvvevvvsnvpvg 213 +++ ++ + +e +++++ +++ +l k+ + ++d ++ +em+e+i kak+d dsvGg++e+ + n+p+g lcl|NCBI__GCF_000008765.1:NP_347532.1 153 GSHILSIKDtKEKYFDKVNidSETLISLTKKAFPVLDDKKGEEMKEVILKAKNDLDSVGGIIECCALNLPAG 224 *******984333333333335555667779***************************************** PP TIGR00033 214 lGeplfdkldaelasallsinAvKgveiGdGFeaasvrGseanDelvleddkirrktnnsGGieGGitnGed 285 G+p+fd+ ++ l++ l+si+AvKgve+G+GF+ ++++GseanD+++++++ +++ +nn+GGi+GGit G++ lcl|NCBI__GCF_000008765.1:NP_347532.1 225 KGDPFFDSCESILSHMLFSIPAVKGVEFGEGFNITKMKGSEANDDFYTKNGIVKTYSNNNGGILGGITSGMP 296 ************************************************************************ PP TIGR00033 286 irvriavKpiptikkplktvdletkekakat.kgRhDpcvvpravpvvEamvalvlada 343 +++r+a+Kp+++i+kp+kt++++t+e+ +++ kgRhDpc+v+ravpvvEa+ al ++d lcl|NCBI__GCF_000008765.1:NP_347532.1 297 LVFRAAFKPTASIYKPQKTINMKTMENEEISiKGRHDPCIVLRAVPVVEAACALSILDI 355 ******************************************************99986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (356 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.88 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory