Align Carbamoyl-phosphate synthase pyrimidine-specific small chain; Carbamoyl-phosphate synthetase glutamine chain; EC 6.3.5.5 (characterized)
to candidate NP_349252.1 CA_C2645 carbamoyl phosphate synthase small subunit
Query= SwissProt::P25993 (364 letters) >NCBI__GCF_000008765.1:NP_349252.1 Length = 351 Score = 359 bits (921), Expect = e-104 Identities = 164/351 (46%), Positives = 239/351 (68%), Gaps = 2/351 (0%) Query: 1 MKRRLVLENGAVFEGEAFGSLEHNMGEVVFNTGMTGYQEILSDPSYCGQIVTLTYPLIGN 60 MK + LE+G VF G FG + GE+VFNT MTGYQEIL+DPSY GQI+ +TYPLIGN Sbjct: 1 MKGIIYLEDGTVFYGTGFGKEGNEFGEIVFNTSMTGYQEILTDPSYAGQIINMTYPLIGN 60 Query: 61 YGINRDDFESITPFVKGLIIKELCELPSNWRSAYTLDEYLKMKNIPGLQGIDTRKLTRMI 120 YG+N +S + KG I+K + E PSN+ S +D+ LK + G+ G+DTR +T+ I Sbjct: 61 YGVNESVNQSKCVYAKGFIVKNIDENPSNYTSEINIDQMLKNMGVVGVFGVDTRSITKKI 120 Query: 121 RTAGALKGTFASSDEDIEAVLKRLNETELPRNQVSQVSAKTAYPSPGRGKRIVLVDFGMK 180 R+ G +K ++ + IE + K ++ + + + V+ VS K G G ++ ++DFG+K Sbjct: 121 RSYGTMKCIISNGELSIEELKKMMDASNIVDDYVNTVSTKEIIHIAGNGNKVAVMDFGIK 180 Query: 181 HGILRELNKRKCDVIVVPYNITAEEVLQLKPDGIMLSNGPGDPKDVPEAIEMIKGVLGKV 240 + I+ L +R+CD+ + PY+ E+L + PDGI LSNGPGDPK +PEAIE +K ++GK Sbjct: 181 NDIIENLKERQCDITIFPYDTDYNEILNINPDGIFLSNGPGDPKSIPEAIENVKKLIGKR 240 Query: 241 PLFGICLGHQLFALACGANTEKMKFGHRGSNHPVKELATGKVALTSQNHGYTV--SSISK 298 P+FGICLGHQ+ ALA G NT K+K+GHRG NH + ++ K +T+QNHGY V S+ + Sbjct: 241 PMFGICLGHQIIALASGGNTYKLKYGHRGGNHGIYDVQRDKAYITAQNHGYAVDEESVLE 300 Query: 299 TELEVTHIAINDDTIEGLKHKTLPAFTVQYHPEASPGPEDANHLFDRFIEM 349 + +TH +ND T+EG+KHK++P F+VQ+HPE +PGP D +LFD+F+ + Sbjct: 301 NGMIITHRNLNDGTVEGMKHKSIPLFSVQFHPEGAPGPTDTTYLFDQFVNL 351 Lambda K H 0.317 0.136 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 399 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 364 Length of database: 351 Length adjustment: 29 Effective length of query: 335 Effective length of database: 322 Effective search space: 107870 Effective search space used: 107870 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate NP_349252.1 CA_C2645 (carbamoyl phosphate synthase small subunit)
to HMM TIGR01368 (carA: carbamoyl-phosphate synthase, small subunit (EC 6.3.5.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01368.hmm # target sequence database: /tmp/gapView.21959.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01368 [M=361] Accession: TIGR01368 Description: CPSaseIIsmall: carbamoyl-phosphate synthase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-156 506.6 3.6 2e-156 506.4 3.6 1.0 1 lcl|NCBI__GCF_000008765.1:NP_349252.1 CA_C2645 carbamoyl phosphate syn Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000008765.1:NP_349252.1 CA_C2645 carbamoyl phosphate synthase small subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 506.4 3.6 2e-156 2e-156 2 357 .. 4 350 .. 3 351 .] 0.98 Alignments for each domain: == domain 1 score: 506.4 bits; conditional E-value: 2e-156 TIGR01368 2 tlvledGtvfegksfgaekevvGevvFnTsmtGYqEiltDpsYkgqivvltyplignygvneedaeskkikv 73 +++ledGtvf g++fg+e++ +Ge+vFnTsmtGYqEiltDpsY+gqi+ +typlignygvne+ ++sk +++ lcl|NCBI__GCF_000008765.1:NP_349252.1 4 IIYLEDGTVFYGTGFGKEGNEFGEIVFNTSMTGYQEILTDPSYAGQIINMTYPLIGNYGVNESVNQSKCVYA 75 689********************************************************************* PP TIGR01368 74 kglvvkelskevsnyrakesLeeflkeegivaiegvDTRalvkklRekgsmkavisteksekeelvekakes 145 kg++vk++ +++sny+++ +++++lk++g+v++ gvDTR+++kk+R+ g+mk++is+ + + eel++++++s lcl|NCBI__GCF_000008765.1:NP_349252.1 76 KGFIVKNIDENPSNYTSEINIDQMLKNMGVVGVFGVDTRSITKKIRSYGTMKCIISNGELSIEELKKMMDAS 147 **************************************************************9*99999999 PP TIGR01368 146 pkvkevnlvkevstkeayeleqkakkegkklrvvvidlGvKenilreLvkrgvevtvvpadtsaeeikklnp 217 + v+ ++v++vstke +++ +g+k v+v+d+G+K++i+++L++r++++t++p+dt+++ei ++np lcl|NCBI__GCF_000008765.1:NP_349252.1 148 NIVD--DYVNTVSTKEIIHIAG----NGNK--VAVMDFGIKNDIIENLKERQCDITIFPYDTDYNEILNINP 211 9887..9***********9994....5666..**************************************** PP TIGR01368 218 dgillsnGPGdPaaveeaietvkklleakiPifGIclGhqllalalgaktyklkfGhrGaNhpvkdlktgrv 289 dgi+lsnGPGdP+++ eaie+vkkl++ k P+fGIclGhq++ala+g++tyklk+GhrG+Nh + d+++++ lcl|NCBI__GCF_000008765.1:NP_349252.1 212 DGIFLSNGPGDPKSIPEAIENVKKLIG-KRPMFGICLGHQIIALASGGNTYKLKYGHRGGNHGIYDVQRDKA 282 ***************************.******************************************** PP TIGR01368 290 eitsqNHgyavdeeslkeeelevthvnlnDgtveglehkelpvfsvQyHPeaspGphdteylFdefve 357 +it+qNHgyavdees+ e+ + +th+nlnDgtveg++hk++p+fsvQ+HPe++pGp+dt+ylFd+fv+ lcl|NCBI__GCF_000008765.1:NP_349252.1 283 YITAQNHGYAVDEESVLENGMIITHRNLNDGTVEGMKHKSIPLFSVQFHPEGAPGPTDTTYLFDQFVN 350 ******************************************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (361 nodes) Target sequences: 1 (351 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.87 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory