Align phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) (characterized)
to candidate NP_349808.1 CA_C3212 hypothetical protein
Query= metacyc::MONOMER-21148 (267 letters) >NCBI__GCF_000008765.1:NP_349808.1 Length = 483 Score = 170 bits (431), Expect = 5e-47 Identities = 91/257 (35%), Positives = 152/257 (59%), Gaps = 2/257 (0%) Query: 4 DNASLARLTDVIDRLLAPEGCPWDKEQTPESLCDYLVEECFELVEAIRSGNADEVREEMG 63 +N L ++++ L GCPWD+EQ+ +++ L+EEC+E VEAI + D + EE+G Sbjct: 225 NNKDFYDLLNIMEILRGENGCPWDREQSHDTIKRALIEECYEAVEAIEKNDDDMMVEELG 284 Query: 64 DVMFLLAFLGRLYADKGAFTLDDAMANNAAKMIRRHPHVFSDTTYADRDEFLRNWESIKR 123 DV+F + F ++ D+G F ++D ++ KMI RHPHVF + + E L+ W+ IKR Sbjct: 285 DVLFQVVFHAKIGKDEGYFNINDVISGICNKMIERHPHVFKNEQIKNSTEVLQKWDEIKR 344 Query: 124 AEKADAEGEPQGVYDSLPASLPPLLKAYRIHSKAARVGFTWPEDEDVERQVEAEWLELLD 183 ++ D + + +P LP L++A ++ KA++VGF + E+ +V E E+ D Sbjct: 345 KQQ-DLNSYTEEM-KHIPKILPALIRAEKVQKKASKVGFDFRNVEEALDKVLEETREVKD 402 Query: 184 VLAGDDKAAQENELGDLIFSLVELGRRKGIKANTALDMTNLKFLRRFRRMEALARERGLD 243 V G + E+GDLIFS+V + R I + AL+ T KF++RF +E A+++ L Sbjct: 403 VYKGIIRDRIAEEVGDLIFSVVNIARLLDIDSEFALNYTIDKFIKRFYYIEKAAKDKNLK 462 Query: 244 FPALSLDDKDELWNEAK 260 ++SL++ + LW+EAK Sbjct: 463 IESMSLEEMNALWDEAK 479 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 320 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 483 Length adjustment: 29 Effective length of query: 238 Effective length of database: 454 Effective search space: 108052 Effective search space used: 108052 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory