Align aspartate-tRNA ligase (EC 6.1.1.12) (characterized)
to candidate NP_350148.2 CA_C3564 aspartyl-tRNA synthetase
Query= BRENDA::Q5SIC2 (422 letters) >NCBI__GCF_000008765.1:NP_350148.2 Length = 425 Score = 366 bits (940), Expect = e-106 Identities = 193/427 (45%), Positives = 272/427 (63%), Gaps = 10/427 (2%) Query: 2 RVLVRDLKAHVGQEVELLGFLHWRRDLGRIQFLLLRDRSGVVQVVTGGLKLPLPE----S 57 R LV + + + + V+L G++H R LG+I F+LLRDR+G++Q V K+ + E S Sbjct: 3 RCLVNETEKKLEEVVKLQGWVHKLRKLGKIAFVLLRDRTGIIQCVVDAKKIDVKELKLES 62 Query: 58 ALRVRGLVVENAKAPGGLEVQAKEVEVLSPALEPTPVEIPKEEWRANPDTLLEYRYVTLR 117 + + G+V EN G E+Q ++ LS ALE P+EI KE+ N DTL+E R +++R Sbjct: 63 VVEIEGIVKENE---GRFEIQVNSIKTLSKALEKIPIEINKEDMELNIDTLIENRILSMR 119 Query: 118 GEKARAPLKVQAALVRGFRRYLDRQDFTEIFTPKVVRAGAEGGSGLFGVDYFEKRAYLAQ 177 + + K++ + GF +L + FTEI+TPK+V GAEGG+ LF + YF+K AYLAQ Sbjct: 120 NSRVNSVFKIETEIAHGFSEFLVKNGFTEIYTPKIVSEGAEGGTELFKLKYFDKEAYLAQ 179 Query: 178 SPQLYKQIMVGV-FERVYEVAPVWRMEEHHTSRHLNEYLSLDVEMGFIADEEDLMRLEEA 236 SPQ YKQ+MV +ERV+E+ V+R E H T RHLNEY+S+D+EMGFI DE DL+R E Sbjct: 180 SPQFYKQMMVAAGYERVFEIGHVYRAESHDTKRHLNEYISMDLEMGFINDEMDLIRFEIE 239 Query: 237 LLAEMLEEALNTAGDEIRLLGATWPSFPQDIPRLTHAEAKRILKEELGYP-VGQDLSEEA 295 LL + + I LL P+ Q++P + EA IL+E + D+ E Sbjct: 240 LLKYIFQNVRQKCSKSIELLKVEIPTI-QEVPIMPLNEAITILREVYNKKELTTDIDHEG 298 Query: 296 ERLLGEYAKERWGSDWLFVTRYPRSVRPFYTYPEEDGTTRSFDLLFRGLEITSGGQRIHR 355 E L+G + KE++ SD++F+T Y + RP YT P T SFDL+FRG+EIT+GGQRI+ Sbjct: 299 EELIGRFVKEKYNSDFVFLTHYSKDKRPMYTMPCGKNLTHSFDLIFRGMEITTGGQRIND 358 Query: 356 YEELLESLKAKGMDPEAFHGYLEVFKYGMPPHGGFAIGAERLTQKLLGLPNVRYARAFPR 415 Y+ L +S+ KG+ E+F YL+VFK+GMPPHGG AIG ER+T KLL L N+R A F R Sbjct: 359 YDMLRQSMLDKGLKVESFKSYLDVFKFGMPPHGGLAIGLERITIKLLNLDNIREAAFFVR 418 Query: 416 DRHRLTP 422 D+ R+ P Sbjct: 419 DKKRILP 425 Lambda K H 0.320 0.140 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 431 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 422 Length of database: 425 Length adjustment: 32 Effective length of query: 390 Effective length of database: 393 Effective search space: 153270 Effective search space used: 153270 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate NP_350148.2 CA_C3564 (aspartyl-tRNA synthetase)
to HMM TIGR00458 (aspS: aspartate--tRNA(Asn) ligase (EC 6.1.1.23))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00458.hmm # target sequence database: /tmp/gapView.8267.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00458 [M=428] Accession: TIGR00458 Description: aspS_nondisc: aspartate--tRNA(Asn) ligase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-128 415.2 8.4 2e-128 414.9 8.4 1.0 1 lcl|NCBI__GCF_000008765.1:NP_350148.2 CA_C3564 aspartyl-tRNA synthetas Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000008765.1:NP_350148.2 CA_C3564 aspartyl-tRNA synthetase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 414.9 8.4 2e-128 2e-128 13 428 .] 15 425 .] 5 425 .] 0.95 Alignments for each domain: == domain 1 score: 414.9 bits; conditional E-value: 2e-128 TIGR00458 13 kevllrgwvheirdlGalifvllrdregliqilvkkkkvskelfklikklkkesvvavkGkvkekekapqgl 84 + v l+gwvh++r+lG+++fvllrdr g+iq +v +kk++ +k+lk+esvv ++G+vke+e + + lcl|NCBI__GCF_000008765.1:NP_350148.2 15 EVVKLQGWVHKLRKLGKIAFVLLRDRTGIIQCVVDAKKID------VKELKLESVVEIEGIVKENE---GRF 77 44679*********************************96......7899*************987...78* PP TIGR00458 85 eiipeklevlneakeplPldlee.kveaeldtrldarfldlrrpkvqaifkirsevlesvreflaeegfiev 155 ei ++++++l++a e +P+++++ +e ++dt +++r+l +r+ +v+++fki++e+ + + efl ++gf+e+ lcl|NCBI__GCF_000008765.1:NP_350148.2 78 EIQVNSIKTLSKALEKIPIEINKeDMELNIDTLIENRILSMRNSRVNSVFKIETEIAHGFSEFLVKNGFTEI 149 ********************9754899********************************************* PP TIGR00458 156 ntPklvasateGGtelfeityfereaflaqsPqlykqvllaaglervyeiaPifraeehntkrhlnevisid 227 tPk+v+ +eGGtelf++ yf++ea+laqsPq+ykq+++aag+erv+ei+ ++rae h+tkrhlne is+d lcl|NCBI__GCF_000008765.1:NP_350148.2 150 YTPKIVSEGAEGGTELFKLKYFDKEAYLAQSPQFYKQMMVAAGYERVFEIGHVYRAESHDTKRHLNEYISMD 221 ************************************************************************ PP TIGR00458 228 iemafedh.kdvldileelvvrvfedvaeklkkelevlevklevpeeklerltydeaieilrakGkeikdge 298 +em f ++ d + el++ +f++v +k++k++e+l+v+++ ++++ + +eai ilr ++ + lcl|NCBI__GCF_000008765.1:NP_350148.2 222 LEMGFINDeMDLIRFEIELLKYIFQNVRQKCSKSIELLKVEIPT-IQEVPIMPLNEAITILREVYNKKELTT 292 *****988578999999***********************9998.677889999****************** PP TIGR00458 299 dlsteaekllG....ekmdgly.fitdfPteikPfytmPdednPeisksfdllyrdleissGaqrihdydll 365 d+ +e e l+G ek+++++ f+t + + +P+ytmP + ++sfdl++r++ei++G qri dyd+l lcl|NCBI__GCF_000008765.1:NP_350148.2 293 DIDHEGEELIGrfvkEKYNSDFvFLTHYSKDKRPMYTMPC--GKNLTHSFDLIFRGMEITTGGQRINDYDML 362 **************9*****9967888************9..56799************************* PP TIGR00458 366 vekikakGlePeslksyleafkyGmPPhaGwGlGaerlvmvlldlknireavlfPrdrkrltP 428 +++ kGl+ es+ksyl+ fk+GmPPh G +G+er+++ ll+l+nirea++f rd+kr+ P lcl|NCBI__GCF_000008765.1:NP_350148.2 363 RQSMLDKGLKVESFKSYLDVFKFGMPPHGGLAIGLERITIKLLNLDNIREAAFFVRDKKRILP 425 ************************************************************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (428 nodes) Target sequences: 1 (425 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.03u 0.01s 00:00:00.04 Elapsed: 00:00:00.02 # Mc/sec: 7.02 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory