GapMind for Amino acid biosynthesis

 

Alignments for a candidate for preph-dehydratase in Clostridium acetobutylicum ATCC 824

Align arogenate dehydratase (EC 4.2.1.91) (characterized)
to candidate NP_350203.1 CA_C3620 amino acid ABC transporter substrate-binding protein

Query= BRENDA::Q01269
         (268 letters)



>NCBI__GCF_000008765.1:NP_350203.1
          Length = 264

 Score = 64.3 bits (155), Expect = 3e-15
 Identities = 38/118 (32%), Positives = 61/118 (51%), Gaps = 2/118 (1%)

Query: 8   LVQALACLALLASASLQAQESRLDRILESGVLRVATTGDYKPFSYRTEEGG-YAGFDVDM 66
           LV  LA      SA++   +S L+R+ ++  + +     Y P  ++ +  G  +GFD+DM
Sbjct: 12  LVLTLAIFTGCTSATVSKDDS-LERVKKAKEIVIGIDDTYPPMEFKDKATGKVSGFDIDM 70

Query: 67  AQRLAESLGAKLVVVPTSWPNLMRDFADDRFDIAMSGISINLERQRQAYFSIPYLRDG 124
           A  +A+ LG K   VP S+  +       +FD+  S ISI  ER++   FS PY+  G
Sbjct: 71  ANAIAKKLGVKTKFVPNSFDGIFLALKSKKFDVVHSSISITDERKKAMIFSDPYIYGG 128


Lambda     K      H
   0.322    0.135    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 123
Number of extensions: 2
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 268
Length of database: 264
Length adjustment: 25
Effective length of query: 243
Effective length of database: 239
Effective search space:    58077
Effective search space used:    58077
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 47 (22.7 bits)

This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory