Align Prephenate dehydrogenase protein; EC 1.3.1.12 (characterized, see rationale)
to candidate NP_660990.1 CT0084 prephenate dehydrogenase
Query= uniprot:D8IR44_HERSS (295 letters) >NCBI__GCF_000006985.1:NP_660990.1 Length = 288 Score = 127 bits (319), Expect = 3e-34 Identities = 87/281 (30%), Positives = 142/281 (50%), Gaps = 18/281 (6%) Query: 9 GVGLIGGSFALALRRA----GQAAHIVGVGRSLQSLERARELGI--IDAVATDAASAVQG 62 G+GLIG S AL+RA G+ ++G + + + G +D D A + Sbjct: 12 GLGLIGASLMQALKRAAGATGRNIEMIGFDPAFDAADIVAITGECGLDRFEPDPAK-LYN 70 Query: 63 ADLILVAAPVAQTGPILASIAPHLEPQAIVTDAGSTKSDVVAAARMALGDRIVQFIPAHP 122 ADL+++ APV +L H+ +V+D STK+++ A A+ LG ++FI HP Sbjct: 71 ADLVVLCAPVVTNIALLDEAKRHIRKDTLVSDVSSTKAEIAAKAQ-ELG---IEFIGMHP 126 Query: 123 IAGREKHGPEAALAELYEGKKVVI-TALPENDAADVEIVAAAWRACGAVIHRLSPQEHDA 181 IAGRE+ G +AA EL +G+ V++ T + +A RA G +SP+EHD Sbjct: 127 IAGREQQGYQAASPELLDGRLVILCTECATLETTLATELAGLLRAAGCKPLFMSPEEHDR 186 Query: 182 VFASVSHLPHVLAFALVDDIAAKPHAATLFQYAASGFRDFTRIAASSPEMWRDITLANRD 241 V+A++SHLP +++ AL+ H ++A GF R+A S +WRDI NR Sbjct: 187 VYANISHLPQLISTALM------AHCRENVEWAGPGFASMARLAGSPWAVWRDIVETNRS 240 Query: 242 ALLTEVDAYLLQLQNIRAMIAAGDGPGIEKIYASAQHARQQ 282 + E++A+ L ++ + G+ +E + A Q+ Sbjct: 241 NIADEMEAFSALLADVAGEVRGGNFEALESKFREANDLYQR 281 Lambda K H 0.320 0.132 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 11 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 288 Length adjustment: 26 Effective length of query: 269 Effective length of database: 262 Effective search space: 70478 Effective search space used: 70478 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory