Align Ornithine aminotransferase 1; OAT 1; EC 2.6.1.13; Ornithine--oxo-acid aminotransferase 1 (uncharacterized)
to candidate NP_661271.1 CT0367 acetylornithine aminotransferase
Query= curated2:Q4A0N2 (394 letters) >NCBI__GCF_000006985.1:NP_661271.1 Length = 400 Score = 263 bits (671), Expect = 9e-75 Identities = 137/382 (35%), Positives = 233/382 (60%), Gaps = 9/382 (2%) Query: 15 NYSPLKLALAKGRGAKVWDIEDNCYIDCISGFSVVNQGHCHPKIIKALQEQSQRITMVSR 74 NY+ L L +A G+G+ ++ Y+D I+G V G+ ++ +A+ EQ+ + VS Sbjct: 18 NYARLPLDIASGKGSFLYTASGERYLDMIAGVGVNAIGYGDKRLEQAITEQASKYIHVSN 77 Query: 75 ALYSDNLGKWEEKICKLANKENVLPMNTGTEAVETAIKMARKWGADIKNIDESSSEIIAM 134 K+ +++ V N+GTEA+E AIK+AR++ A +N D ++++++ Sbjct: 78 LFMQKPQFDLAAKLLEISRMSKVFFCNSGTEAIEAAIKLARRFAA--RNGDTDKTQVLSL 135 Query: 135 NGNFHGRTLGSLSLSSQDSYKKGFGPLLNNIHYADFGDIEQLKKLINNQTTAIILEPIQG 194 FHGRT G+LSL+++ Y GF PL+ DF D+E L++ ++N+T A+ +E +QG Sbjct: 136 TNCFHGRTYGALSLTAKPKYVDGFEPLVPETGMIDFNDVEDLERKVSNRTAAVFVEFVQG 195 Query: 195 EGGVNIPPTHFIQEVRQLCNEYNVLLIADEIQVGLGRTGKMFAMEWENTEPDIYLLGKSL 254 EGG++ FI ++++L E++ L++ADEIQ G GRTG F+ + +PD+ + K L Sbjct: 196 EGGIHKVSEAFIAKLKELAKEHDFLIVADEIQAGCGRTGAFFSYMPFDIQPDLVCVAKPL 255 Query: 255 GGGLYPISAVLANQDVMSVLTPGTHGSTFGGNPLACAVSMAALDVLNEEHLVQNALDLGD 314 GGGL P+ A++ ++ V V TPG+HG+TFGGNP+ACA +A ++ + + L+QNAL++G Sbjct: 256 GGGL-PLGAIIGSEKVAEVFTPGSHGTTFGGNPVACAAGLAMIEAILADGLMQNALEVGS 314 Query: 315 RLLKHLQQIESE--LIVEVRGRGLFIGIELNVAAQDYCEQMINKGVLCKETQGNIIRIAP 372 + +++ + I+E+R GL IG+ ++ A+ Y E+ + +GVL T N+IR+ P Sbjct: 315 MMRTAFEKMAEKHAQILEIRQYGLMIGVTVHREAKYYVEEALKRGVLVNATSNNVIRLLP 374 Query: 373 PLVIDKDE----IDEVIRVITE 390 PL I K+E +D + + TE Sbjct: 375 PLSISKEEAQLCLDTLDAIFTE 396 Lambda K H 0.317 0.136 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 300 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 394 Length of database: 400 Length adjustment: 31 Effective length of query: 363 Effective length of database: 369 Effective search space: 133947 Effective search space used: 133947 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory