Align Serine O-succinyltransferase; SST; Homoserine O-succinyltransferase; HST; Homoserine transsuccinylase; HTS; EC 2.3.1.-; EC 2.3.1.46 (characterized)
to candidate NP_661505.1 CT0605 homoserine O-acetyltransferase
Query= SwissProt::S2KHP1 (367 letters) >NCBI__GCF_000006985.1:NP_661505.1 Length = 356 Score = 230 bits (587), Expect = 4e-65 Identities = 128/360 (35%), Positives = 196/360 (54%), Gaps = 23/360 (6%) Query: 3 DARRFIELPGPVRMYRGGELPSVTIAYETWGELRGQGDNALLLFTGLSPSAHAASSMADP 62 D ++ E P+++ GGELP V +AY TWG L + N +L+ L+ +A A S Sbjct: 12 DTTQYFESNEPLQLELGGELPGVRVAYRTWGTLNAEKSNVILVCHALTGNADADS----- 66 Query: 63 SPGWWEYMIGPGKPIDTERFFVIAINSLGSCFGSTGPASINPATGQPYRLDFPKLSVEDI 122 WW M G G+ D R F++ N LGSC+G+TGP S+NP +G+ Y DFP++++ D+ Sbjct: 67 ---WWCGMFGEGRAFDETRDFIVCSNVLGSCYGTTGPMSVNPLSGRHYGPDFPRITIRDM 123 Query: 123 VAAARGACRALGIDHVHTVAGASLGGMDALAYAVMYPGTYRDIISISAAAHATPFTIALR 182 V R R+LGID + + GASLGGM L + MYP ++ + + + + IA Sbjct: 124 VNVQRLLLRSLGIDRIRLIVGASLGGMQVLEWGAMYPEMAGALMPMGVSGRHSAWCIAQS 183 Query: 183 SIQREAVRADPAWAGGNYAPGEGPKDGMRVARQLGILTYRSAEEWLQRFDRERLEGSDDS 242 QR+A+ AD W G Y P P+ G+ AR + + TYR E + QRF R++ E Sbjct: 184 EAQRQAIAADAEWQDGWYDPEVQPRKGLAAARMMAMCTYRCFENYQQRFGRKQREDG--- 240 Query: 243 ANPFAMAFQVQSYMEANARKFADRFDANCYLYLSQAMDLFDMAEHGDGSLEAAVRRIDAK 302 F+ +SY+ K RFDAN Y+ L++AMD+ D+ G S EAA+ + Sbjct: 241 ------LFEAESYVRHQGDKLVGRFDANTYITLTRAMDMHDLG-RGRDSYEAALGALKMP 293 Query: 303 RALVAGVTTDWLFPLWQQRQVAELLEHAGVAVSYHELGSIQGHDAFLVDSERFAPMVAEF 362 +++ + +D L+P +Q ++A L+ + + L GHDAFL+D+E + MV EF Sbjct: 294 VEILS-IDSDVLYPRQEQEELARLIPGSRLLF----LDEPYGHDAFLIDTETVSRMVCEF 348 Lambda K H 0.320 0.135 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 346 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 356 Length adjustment: 29 Effective length of query: 338 Effective length of database: 327 Effective search space: 110526 Effective search space used: 110526 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory