Align ornithine carbamoyltransferase (EC 2.1.3.3) (characterized)
to candidate NP_662003.1 CT1112 ornithine carbamoyltransferase
Query= BRENDA::O93656 (317 letters) >NCBI__GCF_000006985.1:NP_662003.1 Length = 338 Score = 292 bits (747), Expect = 9e-84 Identities = 145/269 (53%), Positives = 192/269 (71%), Gaps = 3/269 (1%) Query: 42 RLLEGKTLAMIFQKPSTRTRVSFEVAMAHLGGHALYLNAQDLQLRRGETIADTARVLSRY 101 R + KT+AMIF KPS RTRVSFE+ + LGGHA+ L + + + E+I D AR+LSRY Sbjct: 50 RPIRHKTVAMIFNKPSLRTRVSFELGVYELGGHAISLEGKSIGVGERESIEDIARLLSRY 109 Query: 102 VDAIMARVYDHKDVEDLAKYASVPVINGLSDFSHPCQALADYMTIWEKKGTIKGVKVVYV 161 DAI+AR+++H+ +E LAK+A +PVIN L+D SHPCQ LAD T++EK +KVV+V Sbjct: 110 NDAIVARLHEHEIIETLAKHADIPVINALTDLSHPCQVLADAFTLYEKGLWRDDIKVVFV 169 Query: 162 GDGNNVAHSLMIAGTKLGADVVVATPEGYEPDEKVIKWAEQNAAESGGSFELLHDPVKAV 221 GDGNNVA+S + L V+A PEGY PDE ++K A NA G+ E+LHDP++A Sbjct: 170 GDGNNVANSWIELAGILPFHFVLACPEGYLPDETLLKQARSNAK---GTIEILHDPMEAA 226 Query: 222 KDADVIYTDVWASMGQEAEAEERRKIFRPFQVNKDLVKHAKPDYMFMHCLPAHRGEEVTD 281 K ADV+YTDVW SMGQE E ER K F PFQ+N +V AKP + MHC+PAHRG+E++ Sbjct: 227 KQADVLYTDVWTSMGQEEEMAERLKAFAPFQINAKMVAEAKPSAVIMHCMPAHRGQEISA 286 Query: 282 DVIDSPNSVVWDEAENRLHAQKAVLALLL 310 +V+D P S++ DEAENRLH QKA++ L+ Sbjct: 287 EVMDGPQSIIIDEAENRLHVQKALMVKLM 315 Lambda K H 0.319 0.134 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 293 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 338 Length adjustment: 28 Effective length of query: 289 Effective length of database: 310 Effective search space: 89590 Effective search space used: 89590 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate NP_662003.1 CT1112 (ornithine carbamoyltransferase)
to HMM TIGR00658 (argF: ornithine carbamoyltransferase (EC 2.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00658.hmm # target sequence database: /tmp/gapView.30527.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00658 [M=304] Accession: TIGR00658 Description: orni_carb_tr: ornithine carbamoyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-113 363.1 0.0 6.2e-113 362.9 0.0 1.0 1 lcl|NCBI__GCF_000006985.1:NP_662003.1 CT1112 ornithine carbamoyltransf Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000006985.1:NP_662003.1 CT1112 ornithine carbamoyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 362.9 0.0 6.2e-113 6.2e-113 1 303 [. 13 315 .. 13 316 .. 0.96 Alignments for each domain: == domain 1 score: 362.9 bits; conditional E-value: 6.2e-113 TIGR00658 1 rhllslldlseeelkellelakklkkekkkgke...ekklkgktlaliFekrstRtRvsfevaayelGaqvl 69 r++l ++ l+ +++ el +++ +k++++++++ + ++ kt+a+iF+k+s RtRvsfe ++yelG++++ lcl|NCBI__GCF_000006985.1:NP_662003.1 13 RDFLGFTGLDAAKIIELFDYSLFIKQQRETNRNsdeFRPIRHKTVAMIFNKPSLRTRVSFELGVYELGGHAI 84 6899999999***************99999887322456789****************************** PP TIGR00658 70 ylnkeelqlgrkesikDtarvlsryvdaivvRvykhedveelakyasvPvingLtdlehPcqilaDlltike 141 l+ +++ +g++esi+D ar lsry daiv+R ++he++e+lak+a +Pvin+Ltdl+hPcq+laD +t++e lcl|NCBI__GCF_000006985.1:NP_662003.1 85 SLEGKSIGVGERESIEDIARLLSRYNDAIVARLHEHEIIETLAKHADIPVINALTDLSHPCQVLADAFTLYE 156 ************************************************************************ PP TIGR00658 142 klgklkevklvyvGDannvanslllaaaklGldvvvatPeglepeaeivkkakkiakenggkleltedpkka 213 k +++k+v+vGD+nnvans + a l +++v+a+Peg+ p+++++k+a+ + g++e+++dp +a lcl|NCBI__GCF_000006985.1:NP_662003.1 157 KGLWRDDIKVVFVGDGNNVANSWIELAGILPFHFVLACPEGYLPDETLLKQARS---NAKGTIEILHDPMEA 225 *999************************************************87...56699********** PP TIGR00658 214 vkdadviytDvwvsmGeeekkeerlkllkpyqvneellelakpevkflhCLPavrGeevtdevlegeasivf 285 +k+adv+ytDvw+smG+ee+ +erlk++ p+q+n ++++ akp+++++hC+Pa+rG+e++ ev++g++si+ lcl|NCBI__GCF_000006985.1:NP_662003.1 226 AKQADVLYTDVWTSMGQEEEMAERLKAFAPFQINAKMVAEAKPSAVIMHCMPAHRGQEISAEVMDGPQSIII 297 ************************************************************************ PP TIGR00658 286 deaenRlhaqkavlkall 303 deaenRlh+qka+++ l+ lcl|NCBI__GCF_000006985.1:NP_662003.1 298 DEAENRLHVQKALMVKLM 315 **************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (338 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.12 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory