GapMind for Amino acid biosynthesis

 

Alignments for a candidate for hom_kinase in Chlorobaculum tepidum TLS

Align homoserine kinase (EC 2.7.1.39) (characterized)
to candidate NP_662291.1 CT1405 shikimate kinase

Query= metacyc::MONOMER-21144
         (185 letters)



>NCBI__GCF_000006985.1:NP_662291.1
          Length = 191

 Score = 60.1 bits (144), Expect = 2e-14
 Identities = 36/120 (30%), Positives = 60/120 (50%), Gaps = 1/120 (0%)

Query: 21  VSIIGMAGAGKTTVGRELALQLGWAHVDTDNLIEATYGTRLQAVADSMDKESFLDVEAGV 80
           + + G +G+GK+T+G  LA  LG+  +D D  IE T G  +  +     + +F  +E   
Sbjct: 7   IFLTGFSGSGKSTIGPLLANSLGFEFIDLDREIELTAGKSINRIFAEDGEAAFRSLELRT 66

Query: 81  IRRIGAR-RTVLSTGGSVVYRHEAMAHLAALGPLVYLDVSLPLILKRIAMNPDRGLAIAP 139
           + +IG + R V+S GG V+        + + G L+YL  S  ++  R+    DR L   P
Sbjct: 67  LEKIGQQERMVVSLGGGVLENDRCFELIRSHGTLIYLKSSPEILTLRLQHKTDRPLLKGP 126


Lambda     K      H
   0.321    0.137    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 81
Number of extensions: 3
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 185
Length of database: 191
Length adjustment: 20
Effective length of query: 165
Effective length of database: 171
Effective search space:    28215
Effective search space used:    28215
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 44 (21.6 bits)

This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory