Align Anthranilate phosphoribosyltransferase; EC 2.4.2.18 (uncharacterized)
to candidate NP_662492.1 CT1609 anthranilate phosphoribosyltransferase
Query= curated2:B3QM44 (351 letters) >NCBI__GCF_000006985.1:NP_662492.1 Length = 351 Score = 527 bits (1357), Expect = e-154 Identities = 258/346 (74%), Positives = 299/346 (86%) Query: 1 MRQQELIQKLLAGADLSAQEMEACIDSIMENRFTDAGTGAILALLQKKGVTPTEAIGAYE 60 MRQQE++QKLL G DLS QEME C++SIMENRFTDAGTGAILALLQKKG TP E IGA Sbjct: 1 MRQQEILQKLLEGHDLSRQEMETCMNSIMENRFTDAGTGAILALLQKKGATPAEVIGACA 60 Query: 61 NLMTRVTPITLPAHAVDTCGTGGDHRGTFNISTAAAFIAAGAGVPIAKHGNRSITSKCGS 120 +++++ TP+TL AVDTCGTGGDH GTFNISTAAAFIA GAG+PIAKHGNRSITSKCGS Sbjct: 61 SIVSKSTPVTLDQQAVDTCGTGGDHTGTFNISTAAAFIACGAGIPIAKHGNRSITSKCGS 120 Query: 121 ADVLEALGYRVDLPASATEEQFRETGFAFLFAPLYHPSMKAVASIRRELGIRTLFNLLGP 180 ADVLEALGY+VDLP ATEE FRETGFAFLFAPLYHPSMKAVA+IR+ELGI+T+FN+LGP Sbjct: 121 ADVLEALGYQVDLPPCATEELFRETGFAFLFAPLYHPSMKAVAAIRKELGIKTIFNMLGP 180 Query: 181 LINPAKVKRQFIGVFDPSVMELYADVLIHAGCQHAMIVHGKTEHGDGLDEASVSGPTTII 240 +INPA V+RQ IGVFDPSVM++YA+VL+ GC+HAM+VHG T + GLDE SV GPT++I Sbjct: 181 IINPAGVRRQLIGVFDPSVMDIYAEVLLLNGCEHAMLVHGSTGNSMGLDEPSVCGPTSMI 240 Query: 241 ELFEGRLCHHTVNPEDFGLNRWSIDELAGGDAETNAQIIRQILDGSATQAQIDAALFASA 300 EL +G++ HTV PEDFGL RW I ELAGGD+ NAQIIR+ILDGSA QA+IDAALFASA Sbjct: 241 ELHQGQIIRHTVEPEDFGLGRWDIGELAGGDSHVNAQIIREILDGSAPQAKIDAALFASA 300 Query: 301 ITCYVSGMGSCIDEGMSMSKESLESLAAMENMNRIIEVNNRLAEEC 346 ITCYVSG SCIDEGMS+SK SLE+ A++ MN II+ N RLA++C Sbjct: 301 ITCYVSGKASCIDEGMSLSKGSLETCEALDKMNLIIKTNQRLAQKC 346 Lambda K H 0.318 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 449 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 351 Length of database: 351 Length adjustment: 29 Effective length of query: 322 Effective length of database: 322 Effective search space: 103684 Effective search space used: 103684 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate NP_662492.1 CT1609 (anthranilate phosphoribosyltransferase)
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01245.hmm # target sequence database: /tmp/gapView.12117.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01245 [M=330] Accession: TIGR01245 Description: trpD: anthranilate phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-112 362.3 0.0 1.5e-112 362.1 0.0 1.0 1 lcl|NCBI__GCF_000006985.1:NP_662492.1 CT1609 anthranilate phosphoribos Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000006985.1:NP_662492.1 CT1609 anthranilate phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 362.1 0.0 1.5e-112 1.5e-112 1 328 [. 7 336 .. 7 338 .. 0.98 Alignments for each domain: == domain 1 score: 362.1 bits; conditional E-value: 1.5e-112 TIGR01245 1 leklldnkdLseeeaeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkvekeeseelv 72 l+kll+++dLs++e+e+ m+ im+++++da +Ail++l+ kg t+ e+ g+ + +k++ v+ + +++v lcl|NCBI__GCF_000006985.1:NP_662492.1 7 LQKLLEGHDLSRQEMETCMNSIMENRFTDAGTGAILALLQKKGATPAEVIGACASIVSKSTPVTLD--QQAV 76 689************************************************************995..9*** PP TIGR01245 73 DivGTGGDglktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvnlelspekvarsleevgig 144 D++GTGGD++ t+NiSTa+a++a +aG+++aKhGnrs++sk+GsaDvLealg++++l p + ++ ++e+g++ lcl|NCBI__GCF_000006985.1:NP_662492.1 77 DTCGTGGDHTGTFNISTAAAFIACGAGIPIAKHGNRSITSKCGSADVLEALGYQVDLPPCATEELFRETGFA 148 ************************************************************************ PP TIGR01245 145 FlfAPkyhpalkevapvRkeLgvrtvfNlLGPLlnParaklqvlGvyskdlvevlaevlknlgvkralvvhg 216 FlfAP yhp++k+va++RkeLg++t+fN+LGP++nPa +++q++Gv+++++++++aevl g ++a++vhg lcl|NCBI__GCF_000006985.1:NP_662492.1 149 FLFAPLYHPSMKAVAAIRKELGIKTIFNMLGPIINPAGVRRQLIGVFDPSVMDIYAEVLLLNGCEHAMLVHG 220 ************************************************************************ PP TIGR01245 217 ....edglDEisltgetkvaelkdgeieeytlspedfglkraeleelkggsaeenaellkevlegkekkakr 284 ++glDE s++g+t ++el++g+i + t++pedfgl r ++ el+gg+ + na++++e+l g + +ak lcl|NCBI__GCF_000006985.1:NP_662492.1 221 stgnSMGLDEPSVCGPTSMIELHQGQIIRHTVEPEDFGLGRWDIGELAGGDSHVNAQIIREILDGSAPQAKI 292 8888899***************************************************************** PP TIGR01245 285 divvlNaaaalyvagkakdlkegvelakeaiksgkalekleelv 328 d+ ++ a+ yv+gka+ + eg++l k ++++ +al+k++ ++ lcl|NCBI__GCF_000006985.1:NP_662492.1 293 DAALFASAITCYVSGKASCIDEGMSLSKGSLETCEALDKMNLII 336 ***********************************999988766 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (351 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 11.12 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory